SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352028 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352028
Domain Number 1 Region: 124-190
Classification Level Classification E-value
Superfamily SH3-domain 1.14e-18
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 2 Region: 382-462
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-18
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 185-249
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-16
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 4 Region: 8-69
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000471
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352028
Sequence length 732
Comment SH3RF2 (Homo_sapiens) SH3 domain containing ring finger 2
Sequence
MDDLTLLDLLECPVCFEKLDVTARVLPCQHTFCKPCLQKIFKAHKELRCPECRTLVFCSI
EALPANLLLVRLLESMRSGQRSWRGGSFRRPGMLTSKNSRKSRTSPRSLQANPFRLVPNI
RIHMDGVPRAKALCNYRGQNPGDLRFNKGDVILLRRQLDKNWYLGEINGVNGIFPASSVE
VIKQLPQPPPLCRALYNFDLRNKDKNDNQDCLTFLKDDIITVISRVDENWAEGKLGDKVG
IFPILFVEPNLTARHLLEKNKGHQSFRTKSLSLVSSSPRGETTNTPTLCRGPGSRRKGPG
QFSITTALNTLNRMVHSPSGHHMVEISTPVLINSSNPSVITQPMEKADLPTSSAGQVSIY
HPAPASPGHSMAMVSLPSSQQHLSANMFVALHSYSAHGPNELDLQKGEGIRVLGKYQDGW
LRGISLVTGRVGIFPNNYVIPIFRKASSFPDSQSPGLYTTWTLSTSSVSSQGSVSEGDPR
QSRPFKSVFVPTAIINPVKSTAGSGALGQGSLRKGRNSMRKNGSLQRPAQSGIPTLVMGS
LRRSPTMTARPQQFQFYQPQGVSSSSSSAVVEMGPKPPSTGEPALTFVNRGSETRIHSAA
SSLLMESKEVPTKSEPPPKPPASAPPSILVKPENSRNGIEKQVKTVRFQNYSPPPTKHHT
SHSSSGKPEQSATLKGSQPEAASLSPEMTILFAHRSGCHSGQQTDLRRKSAFGKATTPVS
TASAMKTMSPSK
Download sequence
Identical sequences G5C839
HGL_H00000352028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]