SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352065 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352065
Domain Number 1 Region: 1431-1567
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-35
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 
Domain Number 2 Region: 1577-1709
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-23
Family Synaptotagmin-like (S variant) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352065
Sequence length 1745
Comment SYTL2 (Homo_sapiens) synaptotagmin-like 2
Sequence
FSYLEKHFCVADELSHCVEPEPSQVPDCSSRDHQQGKPPLLMTPKAKTSSCCGPCVTEIR
KTTDDSISKVLDWFNRSSYSDDSKSSLQHPQGIEPKEKIDSKSQVPIAFVTDDTSLKENG
SKALSPTKVKLKPVRSDLTFQVERKKLLFEEFQDNDANIISKYMNLSQEDTSKEGLGVLQ
PLESYRALSQENKNMDYSQGSKSIGKGNGVPHSTSNYFYNVLEGSDIEVQVPYNTKNIGN
FGKDEPKLLDHEKNKGNSEVSFDSTVVQESNLKDNMKAERKGKEENTSILETSLETENSE
LLPRAADNRSWKKPEVQLHQEAGEVPKNQVEREKYKRVRERISFWEGEREAAAKLTHKEP
TSSGSQEQPSAKALQPEMSQGVSMDSLSTGQNEFTQVIAKLVVLDENDQASHLPSFYSSN
KPKEIRPQISSGPSKNCSSTDQSDKVPLFHNEINEHIKRWPVEDSLHSKRDITLPVLQHP
SNIESEKCTSLKKDKFLIGESSANFKVMSLKERMDEPYTEHVYHYSQFENLKKFWNLGTN
SNSKDNYEVDTTSPKTPVAFNSPKHKKLSDTKSSGKNTHKTEALLSQRNMAGEEMEKLNT
KGIFQVLPDDTTFTLESSRKFTHQLAGNDSSKKNWEKNMEWFVTPVLKEEKHCSDEEIQE
SIVKTSIVSKDYKDTFNDSLQKLLSEASLLVIQPSGGKVCGKQLLEPGVSEDRKWVQKTD
FSDNVQEAKGPTEIPNEHADKAIVPSLDKLLKEATGTSHSSLQTKMEPVTTTTNLQPNEK
EIKENHNTLFYQREITLPFPEGDKTSGNVALTQKAESDEYQLNKENLFQMTAEGSSALAQ
PSHLHGRGSFEDVANFPQDMTFSRDAHLAHQDKALSSQREISETMKRVILPPKLSLNDVN
DTLQRLLREVSLSYPSGREIGPGDMKADFSEGVQTASNPPNPLEVIPPGTAVDTIVPDRK
DFHTFTVLPDEAHEDGSHLAPQMFPSEQLINSSVSIVAQCGKEQPQEVAEIVRETIIQPK
SEYLKFSIHLENLLEETLQTTPSKYGKDTGTLSLSEFIGSTEEPKQAASEFHPEEIQETI
EKAEALLITESAFDTGFEKLLKEISEVPLYQFQVSMKEETPEKESSGSEQASFSDTMPHF
YWATLGSLETKDKSGLKSQVNQCDKVLGGDEAVTDLLVDLCGSTSSRVEISGTPQLYVDH
EIETRDSERDITEGQGDFQKPDFEEAPEAIDVFKNKQPILLTNKKNPTKISKVELMLASS
YKRQDKEQEKEGFSDSDFSDGNTSSNAESSRNTSSSEEEPNPVLKTLERSAARKMPSKSL
EDVSSDPSNQAKVDNLPEELVHSAEDVSTVPSQPDDQFSHPDKLKRMSKSVPAFLQDEAS
CDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKG
NIQFAVDYVESLKELHVFVAQCKDLAAADIKRQRSDPYVKTYLLPDKGKMGKKKTLVAKK
TLNPVFNEILRYKIEKQILKTQKLNLSVWHRDTFKRNSFLGEVELDLETWDWDNKQNKQL
KWYPLKQKTAPVALEAENRGEMKLALQYVPEPIPGKKLPTTGEVHIWVKECFDLPLLRGS
HLNSFVKCTILPDTSRKSRQKTRAVGRKTNNPVFNHTMVYDGFRPEDLMEACVELTVWDH
YKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTLEEVALWEKMVNSPNTWIEATLPLRMLLI
AKISK
Download sequence
Identical sequences G5CAD4
HGL_H00000352065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]