SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352208 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352208
Domain Number 1 Region: 1538-1647
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.34e-23
Family Synaptotagmin-like (S variant) 0.0073
Further Details:      
 
Domain Number 2 Region: 1137-1268
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.69e-22
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 3 Region: 2-117
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.96e-22
Family PLC-like (P variant) 0.05
Further Details:      
 
Domain Number 4 Region: 340-468
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.06e-21
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 5 Region: 194-328
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-19
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 6 Region: 1757-1911
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.51e-17
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 7 Region: 1301-1406
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000387
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352208
Sequence length 2061
Comment MYOF (Homo_sapiens) myoferlin
Sequence
MLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLD
FSSSLEIIVKDFETIGQNKLIGTATVALKDLTGNQSRSLPYKLISLINEKGQDTGATIDL
VIGYEPPSAPHPNDTSGTNVPEMGGEEEENQGNEDRLDSTVRTPGPRGPVGTVSETQLAR
RVTKGKSSRRMLSNKPQDFQLRVRVIEGRQLSGNNIKPVVKVHVCGQTHRTRIKRGNNPF
FDELFFYNVHMTPSELMDEIISIRVYNSHSLRADCLMGEFKIDVGFVYDEPGHAVMRKWL
LLNDPEDASSGAKGYMKVSMFVLGTGDEPPPEKRDCDNDSDDVESNLLLPAGIALRWVTF
MLKIYRAEDIPQMDDAFSQTVKEIFGGTADKKNLVDPFVEVSFAGKKVCTNIIEKNANPE
WNQVVNLQIKFPSMCEKIKLTVFDWDRLTKNDVVGTTYLYLSKIAASGGEVEDFSSSGTG
AASYTANTGETEVGFVPTFGPCYLNLYGSPREYTGFPDPYDDLNTGKGEGVAYRGRILVE
LSTLLEKTPPDKKLEPISNDDLLVVEKYQRRRKYCLSAVFHSATMLQDVGEAIQFEVSIG
NYGNKFDMTCKPLASTTQYSRAVFDGNYYYYLPWAHTKPVVTLTSYWEDISHRLDAVNTL
LVMAERLQMNIEALKSGIQGKIPENQLAKLWLKLIDEVIEDTSYTLPLTEGKPNVTILDT
QIQKLRSRSLSQIHEAAVRMRSEATDAKSTLLEIEDWLDKLMQLMEEPQNSMPDIIIWMI
RGEKRLAYARVPAHQVLYSTSGEKASGKYCGKTQTILLKYPQEKTNGPKVPVELRVNIWL
GLSAVEKKFNSFAEGNFTVFAEMYENQALMFGKWGTSGLVRRHKFSDVTGKIKLKREFFL
PPKGWEWEGDWIVDPERSLLTEADAGHTEFTDEVYQNESRYPGGEWKSAEDTYTDANGDK
AASPSEFTCPPGWEWEDDAWVYDINRAVDESGWEYGITIPPDNKPKSWVAAEKMYHTHRR
RRLVRKRKKDLTQTSSSTARAMEQFEDREGWEYASLIGWKFHWQQRSSDTFRRRRWRRKM
APSETHGAAAIFKLEGALGADTTEDGDEKSMEIQKHSATTVFGANTPIVSCSFDRVYIYH
LRCYIYQARNLMALDKDSFSDPYAHVSFLHRSKTTEIIHSTLNPTWDQTIIFDEVEIYGE
PQTVLQNPPKVIIEHFDNDQVGKDEFLGRSICPPLVKLNSEMDITPKLLWHPVMNGDKAC
GDVLVTAELILRDKDGSNLPILPSQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNYQ
MASITSPSLVVECGGERVESVVIKNLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDH
RQFGRKPVVGQCTIDRLDRFRCDPYAGKEDIVPQLKASLMSAPPCRDVVIEIEDTKPLLA
SKLTEKEEEVVDWWSKFYASSGEHEKCGQYIQKGYSKLKIYYCELEDVADFEGLTDFSDT
FKLYRGKSEENEDPSVVGEFKGSFRIYPLLDDPSMPAPPRQFRELPDSVPQECTVRIYIV
RGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYELTCYLPQEKDLKI
SVYDYDAFTRDEKVGETIIDLENRFLSRFGAHCGIPEQYCVSGINTWRDQLRPTQLLQNV
ARFRGFPPPILSEDGSRIRYGGKDYSLDEFEANKILHQHLGAPEERLALHILRTQGLVPE
HVETRILHSTFQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKSKRYYLRVIIWNTKDV
ILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQL
CIISKKEHFWSIDQTEFRVPPRLIIQIWDNDKFSLDDYLGFLELDLHHTIIPAKSSDKCN
LDMILDFKAVNPLKTKTVSLFEQKSMKGWWPCYADKDGCRVMAGKVEMTLEVLNEKEADE
RPAGKGRDEPNMNPKLDPPNRPETSFLWFTNPCKTMRFIVWRRFKWVIIGLLILLILLLF
LAVLLYSLPNYLSMKIVKPNV
Download sequence
Identical sequences G5BE80
HGL_H00000352208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]