SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352288 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352288
Domain Number 1 Region: 60-462
Classification Level Classification E-value
Superfamily Sema domain 7.59e-99
Family Sema domain 0.0004
Further Details:      
 
Domain Number 2 Region: 1310-1378,1414-1471,1656-1812
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.61e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 797-891
Classification Level Classification E-value
Superfamily E set domains 2.57e-16
Family Other IPT/TIG domains 0.0096
Further Details:      
 
Domain Number 4 Region: 889-979
Classification Level Classification E-value
Superfamily E set domains 0.000000000000152
Family Other IPT/TIG domains 0.04
Further Details:      
 
Domain Number 5 Region: 465-515
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000117
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 977-1090
Classification Level Classification E-value
Superfamily E set domains 0.000028
Family E-set domains of sugar-utilizing enzymes 0.086
Further Details:      
 
Weak hits

Sequence:  HGL_H00000352288
Domain Number - Region: 760-794
Classification Level Classification E-value
Superfamily Plexin repeat 0.0103
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number - Region: 1814-1889
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0596
Family p120GAP domain-like 0.066
Further Details:      
 
Domain Number - Region: 1495-1587
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0767
Family Ubiquitin-related 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352288
Sequence length 1922
Comment PLXNB2 (Homo_sapiens) plexin B2
Sequence
MLLLTQDPGYASKQDCLAEVASQAHTLLRRPRVLGAMVLQLWALAFLGLLGFGMSLRPRR
LDVFSSEMELNHLVVDEASGVVYVGAVNTLYQLSADLRLQQRAVTGPALDNKKCTPPIEP
SQCHEAVYTDNVNQLLLLDPPGKRLVECGSLFKGICALRALSNISVLLFYEDGSGEKSFV
ASNDESVATVGLVSSTHQEGERVLFVGKGNGPHDNGIIVSTRLLDRAEGREAFEAYSDHT
TFKAGYLSTSTQQFVAAFEDGPYLFFIFNQQDKHPAQNRTLLARMCKDDPSYYSYVEMDL
QCRGPSDHGDPEGSPFGACLAASVASPGTRDTGRDIFYKPFHGDIQCGGHLPGASENFPC
GSEHLPYPLGSRDGLKATAVLQRGGLNLTAVTVTAEDEHTVAFLGTSDGRILKVYLAPDG
TSTEYSSILVELNRRIKQDLVLSGNLSSLYSMTQDKVFRLPVQECLSYSTCAQCRDSQDP
YCGWCVVEGRCTRRTECPRAEETGHWLWSRNKTCVEITDTQPQNMSRRAQGDVWLTVSPL
PALTSDDKLLCLFGESPAHIARLDGNAVICISPNSIPSTPSGQDHVAVSVQLLFERGSVF
LTSHQYPFYDCQKAMSLVENLPCISCASNRWTCQWDLLYHECREASRNPEGSIIRAHMED
SCPQFLSPTPLVIPMNHETGVTFKGKNLDTVKGSSLYVGSDLLKFEVPVTMQEPGTFFFR
TPKLSHDANETLPLHLYVKSYGKNIDSRLQVTLYNCSFGRSDCSLCLAADPNYRCVWCPG
HSRCVYETLCSNATSECPAPVITRVQPETGPLGGGIHVTILGSNLGIRANDVKRITVAGQ
NCSFEPKQYSVSTRIVCVIEAAQEPFTGGVEVEVNGKLGYSPPSVQFTYQQPQPLLVEPN
QGPQAGGTTLTISGTHLDTGSKEDVRVTLNDVPCEVTEFGEQLQCVTGPQPTLGEVALDI
SYGGSRVPSPGISFTYRENPVLRAFEPLRSFVSGGRSINVTGQGFSLIQKFSMVVIAEPL
QSWRRRREAGPLQATTVIGTEYVFHNDSKVVFLSPAVPEEPEAYNLTALIQMDGHRALLR
TETGTFEYVADPTFENFTGGVKKQVNKLIHAQGTNLNKAMTLQEAEAFVGAERCIMKTLT
ETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSLILP
LVIVPMVAVIVVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEMEDQ
TNDVHEAGIPTLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPESRRPVVEQALYQFSNLL
NSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLFLELLMEHVVAKNPKLMLRRSETVVERMLSNWMSICLYQ
YLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQD
EGLDAIPVKVLNCDTISQVKEKIIDQVYRTQPCSCWPKPDSVVLEWRPGSTAQILSDLDL
TSQRDGRWKRINTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERLSGPPPTGHALLE
EENRVWHLVRPADEVEEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV
LAPGHAVPPAVKYFFDFLDEQAERQDLRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVH
VHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMV
QVSDQDMNTHLAEISRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAE
ISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVT
DL
Download sequence
Identical sequences G5B2H8
HGL_H00000352288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]