SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352358 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352358
Domain Number 1 Region: 33-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.61e-33
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352358
Sequence length 602
Comment TRPV6 (Homo_sapiens) transient receptor potential cation channel, subfamily V, member 6
Sequence
MGLSLPGEKGLILCLWNKFCGLFHRQDSWAQSRDELNLLQQKRIWESPLLLAAKENDVQA
LSKLLKYEACDVHQRGAMGETALHIAALYDNLEVAMVLMEAAPELVFEPMTSELYEGQTA
LHIAVMNQNMNLVHALLIHGASVSARATGVAFQRSSNSLIYYGEHPLSFAACVGSEEIVR
LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRRDHLQCLELMPNHQGL
TPFKLAGVEGNTVLFHHLMQKRKRIQWTYGPLTSTLYDLTEIDSAGDEQSLLELIVTTKK
REARQILDQTPVKELVSLKWKRYGRPYFCMLGAVYLLYIICFTVCCVYRPLKPRTTNHTS
PRDNTLLQQKLLQEAYVTPEDNLRLVGELVSVVGAMIILLVEIPDIFRLGVIHFFGHTIL
GGPFHVIIVTYAFMVLVTMVMRLTNADGEVVPMSFALVLGWCNVMYFARGFQMLGPFTIM
IQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYNYPMALFSTFELFLTII
DGPANYDVDLPFMYSITYAAFAIIAALLMLNLLIAMMGDTHWRVAHERDELWRAQVSPWQ
LG
Download sequence
Identical sequences G5ALH6
HGL_H00000352358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]