SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352444 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352444
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-25
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.69e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 555-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.96e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 708-760
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 303-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 517-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000125
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Weak hits

Sequence:  HGL_H00000352444
Domain Number - Region: 137-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00598
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352444
Sequence length 767
Comment ZNF33B (Homo_sapiens) zinc finger protein 33B
Sequence
IEQKSQGSVSFTDVTVGFTQEEWQHLDTSQKSLYRDVMLENYNHLVSVGYCVTKPELIFR
LEQGEEPWILEEEFSRQSFSEFWKTDHLKERSQENQPKHFWGIVFINNTMLTKEQGNVIG
KPFDLDINSFPSRKILCHCDSYGMSFKNISELFISRKNYLGKKPDELNACGKLLLEIQHE
KTHTREKSECLKHKSSFGHQEDPIHPEDIETLDKTLEYSECHETFLEKTLVSTHKREENT
EENDCEYNACRTFSDGSFILFSEVSPSKENHCENNDEKSYCGTSTPFKHDGVHMRYSESG
SDFRRKLCLSQLQKTHKGEKHFECNECGKAFWEKSHLTRHHRVHTGEKPFPCNVCGKTFW
EKSNLIKHNRSHTGEKPFECSHCRKAFGHQSALTLHQRTHTGEKPYQCTACGKTFYQKSD
LTKHQRTHTGLKPYECYECGKSFCMNSHLTVHQRTHTGEKPFECPECGKSFCQKSHLTQH
QRTHIGDKPYACNACGKTFYHKSVLTRHQIIHTGLKPYKCYECEKTFCLKSDLTVHQRSH
SGEKPFACPECGKFFSHKSTLSQHYRTHTGERPYECQECGKIFYNKSYLTKHNRTHTGEK
PYECSECGKTFCQKSQLTQHQRIHIGEKPYQCTECGKAFCHKSALIVHQRTHTEEKPYKC
NECGKSFCVKSGLVLHQRKHTGEKPYACNECGKSFSHKSSLTVHHRAHTGEKSCQCNECG
KIFYRKSDLAKHQRSHTGEKPYECDICKKTFSQKSNLIVHQRTHTGE
Download sequence
Identical sequences G5BD23
HGL_H00000352444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]