SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352612 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352612
Domain Number 1 Region: 153-243,301-384
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.91e-46
Family Canonical RBD 0.0000259
Further Details:      
 
Domain Number 2 Region: 56-147
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.57e-29
Family Canonical RBD 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352612
Sequence length 387
Comment ELAVL2 (Homo_sapiens) ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B)
Sequence
MAVRLCDVASLLRSGSWAAEPWTGVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSG
NTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKD
AEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRII
TSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTNQ
AILSQLYQSPNRRYPGPLAQQAQRFRLDNLLNMAYGVKRFSPMTIDGMTSLAGINIPGHP
GTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAM
AIASLNGYRLGDRVLQVSFKTNKTHKA
Download sequence
Identical sequences D2H5B3 G5BA28 G7NFQ4 G7PS74 L5KX90
ENSP00000369453 ENSGGOP00000003616 XP_005977991.1.78601 XP_016869902.1.92137 XP_016869903.1.92137 XP_021531022.1.9421 XP_021531023.1.9421 XP_021536697.1.83697 ENSGGOP00000027204 ENSDORP00000009808 ENSVPAP00000004737 ENSSARP00000005153 ENSPVAP00000002538 ENSMMUP00000039323 ENSPVAP00000002538 ENSDORP00000009808 ENSOPRP00000011749 ENSSARP00000005153 9544.ENSMMUP00000013125 9598.ENSPTRP00000035622 HGL_H00000352612 ENSMMUP00000013125 ENSOPRP00000011749 ENSVPAP00000004737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]