SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352685 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352685
Domain Number 1 Region: 418-567
Classification Level Classification E-value
Superfamily TRAF domain-like 2.45e-52
Family MATH domain 0.0000000488
Further Details:      
 
Domain Number 2 Region: 379-417
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.000000000000732
Family Trimerization domain of TRAF 0.00032
Further Details:      
 
Domain Number 3 Region: 27-74
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000127
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000352685
Domain Number - Region: 262-304
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00196
Family SIAH, seven in absentia homolog 0.03
Further Details:      
 
Domain Number - Region: 318-410
Classification Level Classification E-value
Superfamily Tropomyosin 0.0504
Family Tropomyosin 0.024
Further Details:      
 
Domain Number - Region: 170-280
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0795
Family Di-heme elbow motif 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352685
Sequence length 569
Comment TRAF2 (Homo_sapiens) TNF receptor-associated factor 2
Sequence
MAVASVTPPGSLDLLQPGFSKTLLGTKLEAKYLCSACKNVLRRPFQAQCGHRYCSFCLNS
ILSSGPQNCTACVHEGIYEEGVSILESSSAFPDNAARREVESLPAICSNEGCTWKGTLKE
YEVKQGVPVGQCPQSGSGAGRTHGPGEACMLCGARSPGWEEGMQTPSMCTCRGCPRAHVC
PAYTPFLCCQSCHEGLCPFLLTECPACKGRVRLGERERHAEQECPERSLACRHCRAPYCR
VDLEAHYEVCPKFPMACDGCGKKKIPREKFQDHVRTCGKCRVPCRFHAVGCPELVEAEEL
QGHEGQWLREHMALLLSALLEAQTLLGGQSQAGPELLQRCQALERKTATFENIVCVLNRE
VERVAVTAEACTRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVLELEAATYDG
VFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFV
VMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLF
CPVSKMEAKNSYVRDDAIFIKAIVDLTGL
Download sequence
Identical sequences G5BEI4
HGL_H00000352685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]