SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352841 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000352841
Domain Number - Region: 59-225
Classification Level Classification E-value
Superfamily Tropomyosin 0.000405
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352841
Sequence length 459
Comment C6orf182 (Homo_sapiens) Cep57-related protein (Centrosomal protein of 57 kDa-related protein)(Cep57R)
Sequence
MDSELMHSIVGSYFKPPERVFVPPFIQDETSQKCHPVNLEVTAPKMLHSPNSQALTWALQ
TLQEKIHRLELERTQAEDNLNILSREAAQYKKALENETNERNLAHQELIKQKKDISIQLS
SAQSRCTLLEKQLEYTKRMVLNVEREKNMILEQQAQLQREKEQDQMKLHAKLEKLDVLEK
ECFRLTTTQKTAEDKIKHLEEKLQEEEHQRKLFQDKAAELQTGLEISKILMSSVSNSKHS
KEKKKSSKKTKCLRKEPPPQIYSKFRAPLFEAKKHKMYHCSPHVFPKHAHVIEPRCLCKP
PRTVSQYNAVPCESEKSVSICDNLSELLMAMQDELDQMSMEHEELLKQMKETESHSMCDD
IECELECLVKKMEIKEKQISKLKKHQDSVHKLQQKVQNSKKSKALGIQQDSNQGLKSMKN
SPRKCLNEANSSQKSSNFHPIRVHNIQAKLRRDDIMWEQ
Download sequence
Identical sequences G5B4I3
HGL_H00000352841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]