SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352956 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352956
Domain Number 1 Region: 260-344
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.84e-29
Family Canonical RBD 0.0026
Further Details:      
 
Domain Number 2 Region: 143-248
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-19
Family Canonical RBD 0.00000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352956
Sequence length 436
Comment RBM23 (Homo_sapiens) RNA binding motif protein 23
Sequence
MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDSPSSATSSTSHSGSGTSRSNTTRDTSK
KKRSRSHSRSRDRKYSHSRDRDRHCERRSGSRSGDRQQRPCSQSWDRPHSSESRSQDWRR
EDYVPYRRLPLATGWRYGPSKSPHFRERSPVREPVDNLSPEERDARTVFCMQLAARIRPR
DLEDFFSAIGKVHDVRIISDRNSRRSKGIAYVEFCDIQSVPLAIGLTGQRLLGVPIVVQA
SQAEKNRLAAMANNLQKGSGGPKRLYVGCLHFNITEDMLRGIFEPFGKIENIVLMKDSET
GHSKGYGFITFSESECARRAVEQLNGFELAGRPMRVGHLTERADGGTDITFPDGDQVVDL
GSAGGHLQLMAKGSGIHLPITAAAAQAAALQLNGVVPLSALNPAALTALSPALKLTSQAV
ASQCFQHPSLFTPQTM
Download sequence
Identical sequences G5ASJ5
HGL_H00000352956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]