SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000353206 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000353206
Domain Number 1 Region: 1215-1370,1406-1485
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-41
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1534-1725,1759-1784
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-38
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 769-917,951-998
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-29
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 4 Region: 217-280,370-439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-16
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 5 Region: 102-211
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000863
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000353206
Domain Number - Region: 1791-1831
Classification Level Classification E-value
Superfamily EF-hand 0.0173
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000353206
Sequence length 2016
Comment SCN3A (Homo_sapiens) sodium channel, voltage-gated, type III, alpha subunit
Sequence
MAQALLVPPGPESFHLFTRESLAAIEKHAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKLNGKSDLKNTCKDQDMLIMCTILTNCVFMTLS
NPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFSVIVMAYVTEFVS
LGNVSALRTFRVLRALKTISVIPGKKKLVYVTEFVDLGNVSALRTFRVLRALKTISVIPG
LKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSNSAFETNTT
TYFNGTMDSNGTFINITMSTFNWKDYIGDDNHFYVLDGQKDPLLCGNGSDAGQCPEGYIC
VKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGS
FYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDF
SGIGGLGELLESSSEASKLSSKSAKEWRNRRKKRRQRDHPEGRNSRGEGDRFPKSESEDS
VKRRSFLFSMDGNRLTGDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSEN
DFADDEHSTFEDSESRRDSLFVPPRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCN
GVVSLVGGPSALTSPTGPLQPEGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAMSIASI
LTNTMEELEESRQKCPPCWYRFANMFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIV
LNTLFMAMEHYPMTDQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGII
VSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWRPTLNMLIKIIGNSVGALGNLTLVLA
IIVFIFAVVGMQLFGKSYKECVCKINEDCTLPRWHMHDFFHSFLIVFRVLCGEWIETMWD
CMEVAGQAMCLIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAIGR
MQKGIDYVKNKIRECFQKAFFRKPKVLEIHEGNKIDSCMSNNTGIEISKELNYLKDGNGT
TSGVGTGSSVEKYVIDENDYMSFINNPSLTVTVPIAMGESDFENLNTEEFSSESELEESK
EKLNATSSSEGSTVDVAPPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGK
IWWNLRKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYI
FILEMLLKWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALR
PLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTG
NKFEVSDVNNLSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSR
DVKLQPMYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKISQDIFMTEEQKK
YYNAMKKLGSKKPQKPIPRPSNKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQS
KYMTLVLSRINLVFIVLFTGEFVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIE
KYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAI
FGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDTI
HPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFE
MFYEVWEKFDPDATQFIEFAKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLD
ILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNF
RCFLLKQRLKNITSKYNKDTIKGRIDLPIKDDMVIDKLNGNSTPEKTDGSSSTTSPPSYD
SVTKPDKEKFEKDKTEKXXXRGQRKSKVKRSKERSL
Download sequence
Identical sequences HGL_H00000353206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]