SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000353362 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000353362
Domain Number 1 Region: 755-914,951-1028
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-30
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 2 Region: 88-301
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.06e-29
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 3 Region: 1164-1355
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-24
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 4 Region: 1077-1164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000141
Family Voltage-gated potassium channels 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000353362
Sequence length 1800
Comment CACNA1A (Homo_sapiens) calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
Sequence
MYHHCCKKGNVFFSCHVSIVGALRRATIKKSKTDLLNPEEAEDQLADIASVGSPFARASI
KSAKLENSTFFHKKERRMRFYIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPDWLSDF
LYYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFG
ISVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGG
QFNFDEGTPPTNFDTFPAAIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLT
LFGNCILPKGPRDPGEGKRGDTKVPRPRRAVSVSAASLTLVSDLAIAVDNLANAQELTKD
EQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRTSEMRKQN
LLASREALYGCELDADERWKAAPGDDEERRRHREADGPEGAERRRRHRHAGAPGAYDGDT
RREDKERRHRRRNAGIRGVPTTPGWTCLSDVHAVPLAGALHTDPTMSLSGPNSFFPSVHL
RRENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMRNNKLATGESAGPHNGLGHP
GLPQSLAKMGPSGDPGPTPNPPAVATNPQNSASRRMPNNPGNPANPRPPKTPENSLIVTN
PSSTQPNSAKTARKPDHTSVDMAPACPPPLNHTVVQVNKNANPDPLPKKEEEKKEEEEED
DAGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQ
PNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAF
AFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFM
FIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFHYDNVLW
ALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVA
LIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPF
EYTIMAMIALNTIVLMMKFYGASAAYENALRVFNIVFTSLFSLECVLKVMAFGILNYFRD
AWNIFDFVTVLGSITDILVTEFGNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFL
RLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGID
GEDEDSDEDEFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTA
DCGNEFAYFYFVSFIFLCSFLMLNLFVAGIMDNFEYLTRDSSILGPHHLDEYVRVWAEYD
PAAWGRMPYPDMYQMLRHMSPPLGLGKKCPARVAYKRLLRMDLPVADDNTVHFNSTLMAL
IRTALDIKIAKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAM
MIMEYYRQSKAKKLQAMREEQNRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGGLMA
HDSSVKESPSWVTQRAKEMFQKTGTWSPERGPPSDLPNSQPNPQAVEMREMSTEGYSDSE
HYLPMEGQARAASMPRLPAENQTISDTSPMKRSASVLGPKARRLDDYSLERVPPEDNQRH
HQRRRDRGHRASERSLGRYTDIDTGLGTDLSMTTQSGELPSKERDQERGRPKDRKQLQHH
HHHHHHHPPPDKERYGPERERPDHSRTRARDQHWSRSPSEGREHTAHRQDSGCCSITSAI
Download sequence
Identical sequences G5BYV2
HGL_H00000353362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]