SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000353518 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000353518
Domain Number 1 Region: 5-224
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.13e-62
Family Ankyrin repeat 0.0000402
Further Details:      
 
Domain Number 2 Region: 854-1016
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-44
Family Phosphotyrosine-binding domain (PTB) 0.0027
Further Details:      
 
Domain Number 3 Region: 718-788
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000569
Family SAM (sterile alpha motif) domain 0.0056
Further Details:      
 
Domain Number 4 Region: 636-693
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000143
Family SAM (sterile alpha motif) domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000353518
Sequence length 1083
Comment ANKS1A (Homo_sapiens) ankyrin repeat and sterile alpha motif domain containing 1A
Sequence
VSMWRGPNVNCVDSTGYTPLHHAALNGHKDVVEVLLRNDALTNVADSKGCYPLHLAAWKG
DAQIVRLLIHQGPSHTKVNEQNNDNETALHCAAQYGHREVVKVLLEELTDPTMRNNKFET
PLDLAALYGRLEVVKMLLNAHPNLLSCNTKKHTPLHLAARNGHKAVVQVLLDAGMDSNYQ
TEMGSALHEAALFGKTDVVQILLAAGIDVNIKDNHGLTALDTVRELPSQKSQQIAALIED
HMTGKRSAKDIDKTSTPQPPFLSGMDSVSKKSQGDTEKVVTELIIDFDTSAEEEGPYEAL
YNAISCHSLDSSTSGRSSDRESTSREAEAAGPRTAGVRPRECPPPPAKPPPDEEEEDRID
KKYFPLTASEVEDLFSRVFSSSCLGHRHMHSSTESPSPLTAETKKLVSIDGKTKDHRQSG
GGGSQDSVEGHDGQVPEQFSGLLHGSSPVCEVGQDPFQLLSASGQSHPDGSLQQAACHEA
SMQLEETGVHPPGVSQPGSLDQSKSTGYAAGLPSASSRSHPETLTHTAPPHPAGAEEGTR
SGARSRAPPTSKPKAELRLSRSLSKSDSDLLTCSPTEDTAMGSRSESLSNCSIGKKRLEK
SPSFASEWDEIEKIMSSIGEGIDFSQEQQRISGSRKLEQSVGEWLESLGLQHYESKLLLN
GFDDVRFLGPNVMEEQDLREIGISDPQHRRKLRCGEAWPLALVSFLPSALQVKALGYDGH
SPPSVPSWLDSLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVHLLGHRKRIIASLA
DRPYEEPPQKPPRFSQLRCQDLLSQTSSPLSQNDSCTGQSADLLLPSGDTSRRRHDGLQD
PAAPPQAEPFRVQEEPREAKLTLRPPSLAAPCAPVQSWQHQPEKLIFESCGYAANYLGSM
LIKDLRGTESTQDACAKMRKSTEHMKKTPTIILSITYKGVKFIDASNKNVIAEHEIRNIS
CAAQDPEDLCTFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQK
SRPTGAAVADTIETKASKPVPKPRAGVRKSALEPPDMDQEVQSHASVSWIVDPKPDSKRS
LST
Download sequence
Identical sequences G5BCF4
HGL_H00000353518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]