SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000353590 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000353590
Domain Number 1 Region: 57-588,621-832
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.1e-272
Family Motor proteins 0.00000000000000104
Further Details:      
 
Domain Number 2 Region: 833-958
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.45e-24
Family Myosin rod fragments 0.00023
Further Details:      
 
Domain Number 3 Region: 953-1068
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.01e-21
Family Myosin rod fragments 0.0014
Further Details:      
 
Domain Number 4 Region: 1233-1347
Classification Level Classification E-value
Superfamily Myosin rod fragments 7.59e-18
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 5 Region: 1343-1447
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000034
Family Myosin rod fragments 0.005
Further Details:      
 
Domain Number 6 Region: 1057-1148
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000157
Family Myosin rod fragments 0.0057
Further Details:      
 
Domain Number 7 Region: 31-64
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0000115
Family Myosin S1 fragment, N-terminal domain 0.00082
Further Details:      
 
Domain Number 8 Region: 1513-1624
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000567
Family Myosin rod fragments 0.0015
Further Details:      
 
Domain Number 9 Region: 1681-1797
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000732
Family Myosin rod fragments 0.0059
Further Details:      
 
Weak hits

Sequence:  HGL_H00000353590
Domain Number - Region: 1742-1938
Classification Level Classification E-value
Superfamily Tropomyosin 0.00307
Family Tropomyosin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000353590
Sequence length 1966
Comment MYH10 (Homo_sapiens) myosin, heavy chain 10, non-muscle
Sequence
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGKFIRINFDVTGYIVGANIETYLLEKSRA
VRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETME
AMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVME
FTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQG
ASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIEWNFIDF
GLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKD
KADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQNIQRASF
YDSVSGLHEPPVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRN
TNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEI
LTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDII
IFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQ
EEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMR
ARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQ
LEKVTAEAKIKKMEEEILLLEDQNSKFVKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN
KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDELKIQLAKKEE
ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEA
LKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEELSE
QLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSE
GDRLRMELAEKANKLQNELDNVSTLLEEAEKKGVKFAKDAASLESQLQDTQELLQEETRQ
KLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESL
EEAKKKLLKDVEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQ
KKFDQLLAEEKNISARYAEERDRAEAEAREKETKALSLSRALEEALEAKEEFERQNKQLR
ADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQ
AMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVAAKKKMEIDLKDLE
AQIEVANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEIL
QLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQS
NMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKS
KFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKE
QIEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR
GGPISFSSSRSSRRQLHIEGASLELSDDDTESKTSDVNETQPPQSE
Download sequence
Identical sequences G5B5G2
HGL_H00000353590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]