SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354021-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354021-1
Domain Number 1 Region: 26-112
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.44e-23
Family Canonical RBD 0.00000977
Further Details:      
 
Domain Number 2 Region: 119-185
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000166
Family Canonical RBD 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354021-1
Sequence length 282
Comment HNRNPA2B1 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein A2/B1
Sequence
MSPSSRWAAGSWAAATESTMEREKEQFRKLFIGGLNFETTEESLRNYYKQWGKLTDCVVL
RDPASKRSRGSGFVTFSSMGEVDAAMAARPHSIDGRVVEPKRAVAREESGKSGTHVTVKK
GFGFVTFDDHDPVDKIVLQKYHTINGYNAEVRKALSRQETQEVQSSRSGRGGNFGFGDSG
GGGRNFGPGPGSNFRGGSDEYGSGRGFGDGYNGYGGGSGGGYFGSIPGYGGGRGGYGGGG
PGYGNRGGAMEVVMTTMEEEIMEVEITMILEITTNNLLTMVQ
Download sequence
Identical sequences G5AM55
HGL_H00000354021-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]