SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354087 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354087
Domain Number 1 Region: 15-354
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.77e-118
Family Calpain large subunit, catalytic domain (domain II) 0.000000113
Further Details:      
 
Domain Number 2 Region: 363-507
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.7e-39
Family Calpain large subunit, middle domain (domain III) 0.00012
Further Details:      
 
Domain Number 3 Region: 529-590
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000131
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354087
Sequence length 590
Comment CAPN5 (Homo_sapiens) calpain 5
Sequence
PPLCVAAAAMFSCVKAYEDQNYSSLKRACLRRKVLFEDPHFPATDDSLYYKGAPGPAVRW
KRPKDICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRELLWQKVIPDWKEQEWDP
EKPDNYAGIFHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLA
GCYQALDGGNTADALVDFTGGVSEPIDLTEGDFANDEAKRNQLFERVLKVHSRGGLISAS
IKAVTAADMEARLGCGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREW
NGPWSDTSEEWQKVSKTEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLLNTSYLSIH
KTWEEARLQGAWTRHEDWWQNRSGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKR
STRREGKGENLAIGFDIYKVEENRQYRMHSLQHKVASSIYINSRSVFLRTDQPEGRYVII
PTTFEPGHTGEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPKQVTQVHVLGAAGLKD
STAGANSYVIIKCEGEKVHSPVQKGTSVPEYNVKGIFYRKKPGQPITVQV
Download sequence
Identical sequences G5AW79
HGL_H00000354087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]