SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354414 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354414
Domain Number 1 Region: 208-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-20
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 318-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-16
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 5 Region: 158-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000841
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  HGL_H00000354414
Domain Number - Region: 139-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00462
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 79-115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0517
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354414
Sequence length 373
Comment ZNF627 (Homo_sapiens) zinc finger protein 627
Sequence
MFQDSVTFDDVVVNFTLDEWDLLDYSQRELYRDVVGEIFMSLAFIGEKWNQNIEDWYRNQ
GRNLSHIVESHCESDEGGQCGETFTEILDQNWDQKTLPEVKSQECRVCGVVFLPLSSPSE
PIASPMGQGLNEYQELEGKPHTCRQCEKALGCYCPFQIDDRSHTGEKSHECQGHEEAFIS
VTSLEGYVITHAGGGPHKCSVCGKGLQYPSSLRIHERIHTGEKPFECNQCGKAFSCLGSV
RRHQRTHTGEKPYTCKECGKAFSSLSGLQGHTMRHTGGGPHKCKECGKVFNSPSALKKHE
RTHTGEKPYPCKHCGKGFICSTSVRKHERTHTGEKPYECKQCGKAYISLSGLQGHMIRHT
GDGPYKCKFCRKA
Download sequence
Identical sequences G5AJT4
HGL_H00000354414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]