SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354451 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354451
Domain Number 1 Region: 939-1066,1098-1296
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.85e-60
Family p120GAP domain-like 0.00077
Further Details:      
 
Domain Number 2 Region: 13-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-37
Family Calponin-homology domain, CH-domain 0.0000272
Further Details:      
 
Domain Number 3 Region: 1512-1609
Classification Level Classification E-value
Superfamily RGC domain-like 1.57e-29
Family RGC domain 0.0000107
Further Details:      
 
Weak hits

Sequence:  HGL_H00000354451
Domain Number - Region: 709-772
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000584
Family Motor proteins 0.018
Further Details:      
 
Domain Number - Region: 654-683
Classification Level Classification E-value
Superfamily WW domain 0.000789
Family WW domain 0.0024
Further Details:      
 
Domain Number - Region: 765-832
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0226
Family Motor proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354451
Sequence length 1609
Comment IQGAP3 (Homo_sapiens) IQ motif containing GTPase activating protein 3
Sequence
ERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEESLRNGVLLAKLGH
CFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPLTFFPETTDIYDKK
NMPRVIYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELAKYGLQLPAFSKIG
GILANELSVDEAAVHAAVLAINEAVERGVVEVTFTALQNPSALLGNLREPLAALYQELLA
QAKVEKAADARSHDDRESQDIYDYYLTQAEIQGNINHVNVRGALDIVDDAVERQSPEGLL
EALQDPALALRGVRRDFADWYLEQLSSDREQKAQELGLVELLEKEEVQAAVAAANVKGDQ
QQAMLQAVQRINRAIRRGAASDTVRELMSPAAQLPPVHPCASAVYQQELAVLQQQQGELG
QEELFVAVEMLSAVVLINRALEARDAAGFWSSLRSPASGLAEVEGENARRYFEALVELRQ
VRGVGGAFLSWNDLQAAVSQVNTRVQEETDQVLAISLINEALDQSSSERTLSALLLPAAG
LEDVSLPTAPRYHFLLVAAKRHKAQVTGDPGAVLWLEEIRQGVVRANQDTHTAQRMALGV
AAINQAIREGKAAQTERVLRNPAVALRGLVPGCAYQRALEGARAKKRSAGDTALWVRHSM
KDGTAYYLHLQTLQGTWEQPPGCHLNTSHLTREEIQSTVIRVTAAHDRQQLWKAHVGLVV
KLQAHVRGFLVRQKFAEGSHFLRTRLPAVIKIQAHWRGYRQRKVYLERLQYFKANLDAII
KIQAWARMWAARSQYLRRLRYFQRNVDSVVKIQAFFRARKVRDDYRTLVHSAHPPLGVVR
KFAHLLNQSQQDFLAEVELLKLQEEVVRKIRSNQQLEQDLNLMDIKIGLLVRNRITLQEV
VSHCKKLTKKNKEQLSDMVALDKQKGLKSLSKEKRQKLEAYQHLFYLLQTQPTYLAKLIF
QMPQNKTTRFMEGVIFSLYNYASNCREAYLLLQLFKSALQEEIESKVEHPRDMVTGNPTV
VRLVVRFYRNGRGLSALREILGKAIQDVLQDRALSVHTDPVHLYKSWINQSEAQTGQRSH
LPYEVTPEQALSHPEVQRRLDISLRNLLAVTEKFLVAITSSVEQIPYGMRYMAKVLKTAL
VEKFPDVPESEVVGNLLYYRFLNPAVVAPDAFDIVALAAGGTLAAPQRHTLGAVAQLLQH
AAAGKTFSGESQHLHVLNGYLEETHLKFRKFICRACQVPEPEERFAVDEYSDTVAVAKPM
VYITVGELINTHRHQDWIAPYHQDPLHQLLEDLGELPTVSDLIGESTAADRHPDLSKLEV
SLTLISKFEGPEAAADGTRARSLLLSTKQMLADLIQFHPGDSLEEVLSLSAPREQEVAHE
RLMCQRQACEAQSPEPLRRHHSLTAQSLLPLAEKQRRVLRNLRQLGSLGLVRASDGYQAL
VDELAKDIRNQRRHRQRRKVELVKLRATFQALSTKTAFCEEQGDYYSQYIRSCLDHLAPS
SKNPGKGKKQPSLHYTAAQLLERGVLLEIEDLPASHFRNVIFDISPGDEAGKFEVNAKFL
GVDMERFQLHYQDLLQLQYEGVAVMKLFNKARVNVNLLIFLLNKKFLRK
Download sequence
Identical sequences G5AR88
HGL_H00000354451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]