SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354453 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354453
Domain Number 1 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 460-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.84e-26
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 8 Region: 197-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354453
Sequence length 558
Comment ZFP2 (Homo_sapiens) zinc finger protein 2 homolog (mouse)
Sequence
QELVTVKDVSVDFTWKEWMQLDPAQRNLCGKVMLENYRNLISLGHQLSKPNVMSQLEQEL
GLRNKDLQGYVFPDWETRLEDRELSPKLNITEDLVHGSIMERKGLRHSTLGETWEPDNWL
EEQQGRHLGQVTPKETLTERGVCRGNDLERCSNQDSVLNTQQGIPKSKYPHSWNSHRKDA
KQNTELMKTQRMFVGKKIYECDECGKTFSQSSSLLKHQRIHTGEKPYKCSVCGKHFIERS
SLTVHQRIHTGEKPYKCNECGKAFSQSMNLTVHQRTHTGEKPYQCKECGKAFRKNSSLIQ
HERIHTGEKPYKCNECGKAFTQSMNLTVHQRTHTGEKPYECNECGKAFSQSMHLIVHQRS
HTGEKPYECSECGKAFSKSSTLTLHQRNHTGEKPYKCNKCGKSFSQSTYLIEHQRLHSGV
KPFECNQCGKAFSKNSSLTQHRRIHTGEKPYECMICGKHFTGRSSLTVHQVIHTGEKPYE
CSECGKAFSQSAYLIEHQRIHTGEKPYECDQCGKAFIKNSSLIVHQRTHTGEKPYQCNEC
GKAFSRSTNLTRHQRTHT
Download sequence
Identical sequences G5BCG7
HGL_H00000354453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]