SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354621-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354621-1
Domain Number 1 Region: 426-788
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-122
Family Hect, E3 ligase catalytic domain 0.00000000554
Further Details:      
 
Domain Number 2 Region: 83-204
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.3e-21
Family PLC-like (P variant) 0.047
Further Details:      
 
Domain Number 3 Region: 341-381
Classification Level Classification E-value
Superfamily WW domain 0.000000000000389
Family WW domain 0.00079
Further Details:      
 
Domain Number 4 Region: 297-335
Classification Level Classification E-value
Superfamily WW domain 0.00000000139
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354621-1
Sequence length 795
Comment SMURF1 (Homo_sapiens) SMAD specific E3 ubiquitin protein ligase 1
Sequence
MDELRTIMGSMNAQHRKEMEIMKQIQTDIQEIKNCIGSICSRMSQCEDRISDIETWIAVS
DHEKRDLLKILKGPTTTTTGETFKILCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTV
KNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQ
RLDLCKLNPSDTDAVRGQIVVSLQTRDRIGPGGSVVDCRELLENEGSVYEDSGPGRPLSC
FMEEPAPYTDGTGAAAGGGNCRFVESPSQEQRLQAQRLRNSEVRGSLQTPQNRPHGHQSP
ELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSG
RIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSVEDEELPAQRYERDLVQ
KLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDY
GGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAV
FHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHN
AFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLL
KPFDQKELEVGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVT
GSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYE
KLLTAVEETCGFAVE
Download sequence
Identical sequences G5AX86
HGL_H00000354621-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]