SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354680 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354680
Domain Number 1 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-22
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 4 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 226-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 169-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000265
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354680
Sequence length 553
Comment ZNF266 (Homo_sapiens) zinc finger protein 266
Sequence
MTQESVSFEDVAVDFTQEEWILLDPTQRNLYSDVMLENYQNLASMEWKVGLKTKESALHQ
DFLRGQTSRKIYMAGSHNGAELCDCKPCRDFVSRHPCLRSHIGTQSTGSTSECDQYGIDF
LPPQKEISIEEKLSMSNQCEPTFSQPPAVLYPRRCTKDKPLEGSDHREAFVDPSKLQTDR
RMHSGNKLHELRESGIDFLHSNSHALLMHTHNAEKPYKCKECGKGFRYSAYLNIHMGAHS
GGNPYECKECGKAFTRPCQLTQHKKTHTGEKPYKCTECGKAYTVSSCLSQHLKIHIGEKS
YECKECGTVFTTSSQFTEHVKNHTVKSFECKVCGKSFRNSSCLHDHFRIHTGIKPFKCED
CGKAFIQNSDLTKHIRIHSGERPYECRECGKAFARSSRLHEHMRTHTGEKPFECVKCGKA
FAISSNLSGHLRIHTGEKPFECKECGKAFTHSSSLNNHMRTHSAKKPYTCLECGKAFKFP
TCVTLHMRIHTGEKPYECKQCGKSFRYSNSFQLHERTHTGEKPYECKECGKALSSLSSFQ
NHEQRHTKDKLSV
Download sequence
Identical sequences G5B348
HGL_H00000354680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]