SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354719 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354719
Domain Number 1 Region: 45-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.78e-25
Family Canonical RBD 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354719
Sequence length 246
Comment SNRNP35 (Homo_sapiens) small nuclear ribonucleoprotein 35kDa (U11/U12)
Sequence
MNDWIPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVTGDPLLTLFVARLNL
QTKEDKLREVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERALLKAYRDADGLVVDQH
EVFVDYELERTLRGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGR
RERRERSRSRERHWDFRTRDRDHDRGREKRWQERELARAWPDSDWDRERDLREDRLKGWE
KRDRSK
Download sequence
Identical sequences G5AWS8
HGL_H00000354719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]