SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354739-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354739-1
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.02e-29
Family Ribosomal L11/L12e N-terminal domain 0.0000116
Further Details:      
 
Domain Number 2 Region: 74-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000000641
Family Ribosomal protein L11, C-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354739-1
Sequence length 149
Comment RPL12 (Homo_sapiens) ribosomal protein L12
Sequence
MPPKFDPNEVKVMYLRSTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKVLRIIV
KLTSQNRQAQTEVVPSASALIIKALKEPPRDRKKQKNIKHSGNSTFDEIVNIAQQMRHQS
LARELSGTIKEILGDHPVCGLQCGWLAPS
Download sequence
Identical sequences G5BJM5
HGL_H00000354739-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]