SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354739-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354739-2
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.35e-33
Family Ribosomal L11/L12e N-terminal domain 0.0000064
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.75e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 
Domain Number 3 Region: 157-208
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000000000824
Family Ribosomal protein L11, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354739-2
Sequence length 225
Comment RPL12 (Homo_sapiens) ribosomal protein L12
Sequence
MPPKFDPNEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINTVKHSGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINTGTVECPAS
Download sequence
Identical sequences G5BLH3
HGL_H00000354739-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]