SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354895 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354895
Domain Number 1 Region: 62-157,199-402
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.45e-22
Family WD40-repeat 0.012
Further Details:      
 
Weak hits

Sequence:  HGL_H00000354895
Domain Number - Region: 289-445,499-624
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000267
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 
Domain Number - Region: 1190-1227,1365-1408
Classification Level Classification E-value
Superfamily TPR-like 0.00303
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number - Region: 860-925,1188-1215
Classification Level Classification E-value
Superfamily TPR-like 0.0104
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number - Region: 954-1041
Classification Level Classification E-value
Superfamily TPR-like 0.0474
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354895
Sequence length 1458
Comment IFT140 (Homo_sapiens) intraflagellar transport 140 homolog (Chlamydomonas)
Sequence
MALYFDHQIKAPNSVGSPFHISWHAVHPFLAVASMSAASRGSVDIYLEQGEHVPETHIER
SFRVTSLCWHPTRLLLAVGWETGEVIVFNKQDKEQHTMPPTHITDITILTWSTNGSCLVS
GDRLGVLLLWRLDQRGRVQGTPLLKHEYEKHLTHCIFRLPPPGKDLVQLARAAVNGDEKA
LDMFNWKKSSFGSFLKMGSQEGLSFFISLMDGSVHYVDEKGKTTCVASTHSSIQTLFYIE
KREALVVVTENLLLSLYMVMPEGKAEEVMKVKLSGKTGLRADITLIEGSLLVMAIGEAIL
RFWDLERGDNYILNLEEKFGFEKEENINCICYCKAKGLLAAGTDKGRIAMWKRVAGSPSS
REVEGKDKWAPQTPTELEGNITQIKWGSRKNLLAVNNISSIVILREQAVSLHFHQQVASV
QVSPSLLNVSFLSKGGVYSLHTDMHISGVFATKDAVAVWNGTHVAIFEPSGATLRNAGTF
LCESPVLAMHEENVYTVEPNRVQVRTWQGTVKQLLMFSKTEGNPCFLDICGNFLVVGTDL
AHFKSFDLSRREAKVHCNCRNLAELIPDVGSIISLRCNASGSKISILLSKVDNTPDSRIC
LYDVEMDSVAILDLKTGEIDQRETLPFNGQETNKSHIFTDERLTNYIPMNHYWDQNEPRL
FVCEVMQEALGAQATGGKQPYPEESTSPTEDVLILSFFVSEDHGFLLHDSFPRPPAYQTL
LGMEVPHYYFTKKPGEADGEDRVHSEHYCIPQMVARRPLRDFVGLEDCDKPTQDAMLNFS
FFITVGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGAQALREAE
QEPELEARVAMLAIQLGMLEDAEQLYKKCKRYDLLNKFFQASGQLQKAVEVAEQYDRMHL
RTTYYNYAKHLEANSDCSLALSYYEKSDTHRFEVPRMLAEDLKSLELYINKMKDKTLWRW
WAQYLESQAEMDAALHYYELAQDYFSLVRIHCFQGNIPKAAEIANETGNWAASYHLARQY
ESQEDVRQAVCFYTRAQAFNNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGDQ
MDRAVMLYHKAGHFSKALELAFATQQFAALQLIAEDLDEKSDPALLSRCSDFCIEHKQFE
KAVELLLAAKKYHEALQLCLEQNMTITEEMAEKMTVPKDSKVLSEESRRELLEQIANCCM
RQGNYHLATKKYTQAGNKLKAMRALLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWW
KEPEIMKNIISFYTKGRALDLLAGFYDACAQVEIDEYQNYSKAHGALTEAYKCLAKAKAK
SPLDQETKLAQLQSKMTLVKRFIQARRSYTEDPKESIRQCELLLEETDLDSTIRTGDIFG
FLVERYMQMEDYQMAYRYLEEMRKKLPSANMAYYVDQRTMDTVYRALGLPLTHMLPERTH
HNSIEDQEEVVEEVDNDP
Download sequence
Identical sequences G5BY73
HGL_H00000354895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]