SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355060 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355060
Domain Number 1 Region: 299-514
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-51
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 811-1110
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000961
Family WD40-repeat 0.025
Further Details:      
 
Domain Number 3 Region: 527-605,699-759
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000195
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355060
Sequence length 1271
Comment ARHGEF10L (Homo_sapiens) Rho guanine nucleotide exchange factor (GEF) 10-like
Sequence
MASSNPPAQPAVGDLLVPAAPGPSPEVEDPGEAFEFDDSDDEEDTSTGLGVPCLAPERNE
PLLIHFDSTLGSDLDPATAPPQTEVPAVVSNGDAVDVVFSGVQRSSWKRKSSRRIDRFTF
PALEEDVIYDDVPCESPDAHQPGAERNLLYEDVQRAPREPEDLGWSSSEFESYSEDSGEE
AKPEAEPAKHRVSFQPKLSPDLTRLKERYARTKRDILALRVGGRDMQELKHKYDCKMTQL
MKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDSEEEDMGLLEVSVTDIKPPAPELGPM
PDGLSPQQVVRRHILGSIVQSEGSYVESLKRILQDYRNPLMEMEPKALSVRKCQVVFFRV
KEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFSKSMVLDVYSDYVNNFTNAMSIIKK
ACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGHPDRLSL
QLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSGQRQLLLCETLTET
VYGDRGQLIKSKERRVFLLNDMLVCANINFKGQLEISSLVPLGPKYVVKWNTELPQVQVV
EVGQDGGAYDKDNVLIQHSGAKKASATGQAQNKVCLGPPRLFQELQDLQKDLAVVEQITL
LVSTLHGTYQNLNMAVAQDWCLALQRLLRVKEEEIHSANKCRLRLLLPGKPDKSGRPISF
MVIFITPNPLSKISWVNRLHLAKIGLREENQPGWLCPDEDRKSKAPFWCPILACCVPAFS
SRALSLQLGALVHSPVNCPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVEIFSLNRPSPRT
VKSFPLAAPVLCMEYIPEPEEDPEGRQESRVSADPSAGTVHPTICLGLQDGSILLYGSVD
TGTQCLASCRTPGLQPVLCLRHSASYLLAGLQDGTLAAYPHSSGGVPWDLESLPMCLTVG
PGPVRTLLSLEDAVWASCGPRVTVLDGTTLQTQQSFDAHQDEEVSVTHMVKAGSGVWMAF
SSGSSIRLFHTETLEHLQEINIATRTTFLLPGQKRLCVTSLLICQGLLWVGTDQGVIVLL
PVPRLEGIPKITGKGMVSLNGHCGPVAFLTVATSILAPDILRSDQEEAEGPRAEEDKLDG
QGQELAPAPNSHMGRELTRKKGILLQYRLRSTAHLPGPLLSMREPEPGDSSALEHSEEDG
SIYEMADDPDVWVRSRPCTRDAHRKEICSVAIISGGQGYRNFGSALGSSGKPALCGDSDS
TLLIWQVPLML
Download sequence
Identical sequences G5BZM9
HGL_H00000355060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]