SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355089 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355089
Domain Number 1 Region: 313-407,583-668
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.84e-43
Family Canonical RBD 0.0000319
Further Details:      
 
Domain Number 2 Region: 202-303
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.45e-23
Family Canonical RBD 0.003
Further Details:      
 
Weak hits

Sequence:  HGL_H00000355089
Domain Number - Region: 671-700
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00137
Family Canonical RBD 0.0024
Further Details:      
 
Domain Number - Region: 403-531
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 0.0293
Family beta-Lactamase/D-ala carboxypeptidase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355089
Sequence length 702
Comment CELF4 (Homo_sapiens) CUGBP, Elav-like family member 4
Sequence
MHLVLERQAACECAPLPPGGRIQEGSWEQSDEQLLLELEEMSLTHELRAGPRPGGPAGEY
GEALAGRLRLGLQPADATPRLAPLELGCSKGTPRVQRTPLESGSSCSPESDSGLYFFDAA
GRPKRPPLSRTGQSVRDRNTHPAFEEHRDENGPQVSTLSPPGTAQLLPSPVFPANGQADN
ASLSTNGLGGSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQIPRNLDEKDLKPLFE
EFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADS
ESRGGSSCLRQPPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCA
FVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFNPMA
IPFGAYGAYAQALMQQQAALMASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPT
SGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQSPTAADP
LQQAYAGVQQYAGPAAYPAAYGQISQAFPQPPPMIPQQQREGPEGCNLFIYHLPQEFGDA
ELMQMFLPFGNVISSKVFVDRATSQSKCFGLVSFDTPASAQTAIQAMNGFQIGMKRLKVQ
LKRPKDANRPAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY
Download sequence
Identical sequences G5BZ33
HGL_H00000355089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]