SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355124-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355124-1
Domain Number 1 Region: 231-307
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.71e-22
Family Intermediate filament protein, coiled coil region 0.00097
Further Details:      
 
Domain Number 2 Region: 2-35
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000324
Family Intermediate filament protein, coiled coil region 0.0023
Further Details:      
 
Weak hits

Sequence:  HGL_H00000355124-1
Domain Number - Region: 113-227
Classification Level Classification E-value
Superfamily Prefoldin 0.00112
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355124-1
Sequence length 307
Comment KRT19 (Homo_sapiens) keratin 19
Sequence
GDEKVTMQNLNDRLASYLDKVRALEAANADLEVKIRDWYQKQGPGPARDYSHYFKTIQDL
RDKILGATIENSRIVLQIDNARLAADDFRTKFETELNLHMSVEADINGLRRVLDDLTMTR
SDLEMQIEGLKEELAYLKRNHEEEISALRSQVVGQVSVEVDSAPGTDLTKILSEMRSQYE
VMAEKNRKDAEAWFISQTEVLNKEVATNTEMIQSSKTEITELRRTMQGLEIELQTHLSMK
ATLEGTLAETEERYRVQLAQIQALIGSLEAQLSNLRADTERQNLEYQQLMGLKSRLEQEI
ATYRSLL
Download sequence
Identical sequences G5B0M7
HGL_H00000355124-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]