SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355160-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355160-2
Domain Number 1 Region: 48-185
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 3.4e-41
Family Molybdopterin synthase subunit MoaE 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355160-2
Sequence length 188
Comment MOCS2 (Homo_sapiens) molybdenum cofactor synthesis 2
Sequence
MSSWEIGSSSCNQETKLPLSPQLVEDNAFQPCRKNMDEAEEKSKDIIKCTAEKLLVDEVS
QLVISPVCGAVSLFVGTTRNNSEGKKVISLEYEAYIPMAENEIRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLADVSYAIDTLKAKVPIWKKGSGRESSSSWKRN
KECFWATS
Download sequence
Identical sequences G5BVD5
HGL_H00000355160-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]