SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355378 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355378
Domain Number 1 Region: 201-494
Classification Level Classification E-value
Superfamily Sema domain 3.66e-68
Family Sema domain 0.00036
Further Details:      
 
Domain Number 2 Region: 1222-1350,1519-1699
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.59e-40
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 877-965
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000588
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 4 Region: 784-856
Classification Level Classification E-value
Superfamily E set domains 0.000000014
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 5 Region: 964-1011,1045-1098
Classification Level Classification E-value
Superfamily E set domains 0.0000446
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.085
Further Details:      
 
Weak hits

Sequence:  HGL_H00000355378
Domain Number - Region: 624-655
Classification Level Classification E-value
Superfamily Plexin repeat 0.0602
Family Plexin repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355378
Sequence length 1738
Comment PLXNB3 (Homo_sapiens) plexin B3
Sequence
MLHLARLCQSLGVGLGGDSLAGEKDNALHSPLVPVTTAQGSQAEAKRHTAWETTLLQPSA
PVSSWAPRPQRCRRRGRWVTWPDQGSLGVEPQCPVPPSPEAAAVEIPGPEEVPVPPACVP
EIRGHSGSGQLRCKDLSSTQSLPSSSCPLAGALPRVTSVWCPPSVPRMQGGTVQPSVPFP
WAPLDRSPGRLSIAVFETRSHHFSAPNTTFNHLALAPGRGTLYVGAVNRLFQLSPELQLE
VMAGPGPPDCVPFRDLAECPQARLTDNANQLLLVSSRAQELVACGQVRQGVCEKRHLEDV
ATVLYQAEDPGDGQFVAANTPGVATVGLVVPLPDRDLLLVARGLAGKLSAGVPPLSVRQL
AGPQPFSSEGLGRLVVGDFSDYNNSYVAAFANAHFAYFVFRRRGSRAQAEYRSYVARVCL
GDANLYSYVEVPLACQGQGLIQAAFLTPGSLLGVFAAGLSGAHEALCTFPLAELDSSMER
ARRLCYTAGGGLAFSEQREPVVKVGDGDMGAGLPGTSSLLPVPSGGWHVPVQMANRKAVT
LSVLWLPTLAEDEYFHCAFGDYDSLAHVQGPHVACVTPPEDQVPRNPPGTDHVTLHLALM
FEDVAVATTNFSFYDCSTVQALEVAAPCHTCVSSPWRCHWCPQSSRCVHGEHCPEGERTV
YSTQEEAIQARGPGACPQVEGLAGPHLVPVGWDIGLALHVRNLQYFRGLPASYNCWLELP
GELRRLPASLQETAGDRDRDGGTGLIHCRAQQIEPLTGPTEGGLALTILGSDLGRTFADV
RDADPILLSLSPQWGPQAGGTRLTIHGQHLQTGGNISAFAIVCRTMPQAMPGEAAVLVVF
GHAERKLLTSPFRYTANPRLLAAEPNVSFRGGGRLIRDPILLSLSPQWGPQAGGTRLTIH
GQHLQTGGNISAFVGGQACPILEPMCPEAIVCRTMPQAMPGEAAVLVVFGHAERKLLTSP
FRYTANPRLLAAEPNVSFRGGGRLIRVRGTSLDAVXXXXXXXLSVWLEAEVEVKALGDSN
PRRTCGAPAADPQSCVRLAGGWLQCSTICSVNSSSLLLCRSPAVPDGAHPKRVFFALDNV
HVDFASASGGQGFQYQPNPHLAPLSREGPSRPYRLKPGHVLDVEVQMGNVRLALGPVQYE
AEPTLPAFPVEAQVGLGMGAAVLIAAVLLLTLMYSSDLEASGIPFLDYRTYAERAFFPGH
GGCPPQPKLQGPGEEGHRATVCQALTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVA
SLLSLALHGKLEYLTDIMKTLLGDLAAHYVHKNPKLMLRRTETMVEKLLTNWLSICLYTF
LREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRTLNDSHLLREDVEFRPLTLMVLVGPG
AGGAAGGAEVQRVPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVYTLDLEWRSGLAGH
LTLSDEDLTSVTQNHWKRLNTLQHYKVPADVPMLEEGEEGGMRLWHLVKATEEPEGTKVR
RSSLRERERERARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSMNRPVPLAVKYLFDF
LDELAEKHDIEDPETLHIWKTNSLLLRFWVKALKNPQLIFDVHVSDNVDAILAVIAQTFI
DACTISEHKVGRDSPVNKLLYAREIPRYKQMVEKYYSDIRHSSPASYQEMNSALAELSGN
YTSAPHCLEALQELYNHIHKYYDQIISALEEDPLGQKMQLACRLQQIVALVENKVTDL
Download sequence
Identical sequences G5BQT7
HGL_H00000355378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]