SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355428 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000355428
Domain Number - Region: 88-309
Classification Level Classification E-value
Superfamily Tropomyosin 0.00118
Family Tropomyosin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355428
Sequence length 412
Comment MIR3124 (Homo_sapiens) microRNA 3124
Sequence
MVHLCVGLGPASRPPLPPALGLWPRRLLGSALSGLMAEFRHVPGGRETPQGELRPEVVED
EVPRSPGPEEPGDSGSSSTESKLLPREEEELDPRIQEELEHLNQASEEINQVELQLDEAR
TTYRRILQESARKLNTQGSHLGSCIEKARPYYEARRLAKEAQQETQKAALRYERAVSMHN
AAREMVFVAEQGVMADKNRLAPTWQEMLNHATCKVNEAEEERLRGEREHQRVTRLCQQAE
ARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLE
QISEQIHARRRGLPHPRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPRPGGRRDSDSGARGGRHQRSISL
Download sequence
Identical sequences G5C3K8
HGL_H00000355428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]