SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355454 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355454
Domain Number 1 Region: 15-106
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-36
Family SCAN domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 343-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 446-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000109
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 380-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000334
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 232-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000288
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355454
Sequence length 499
Comment ZNF496 (Homo_sapiens) zinc finger protein 496
Sequence
MRSPPGEKAGPQGEPPSPESSRRLFRRFRYQEAAGPREALRRLWDLCRGWLRLERHTKEQ
ILELLVLEQFLAILPREVQAWVRAQEPESGEQAVAAVEALEREPGRPWQWRKHCEDPVVI
DDGDGPPDLGQEQDRLPLGVLSDPAKSQEAQPTALAPSLGLLSRPPGQLSEGPAPQDARL
LEEDDVGDAQQGATLPLPPVTRHTGPGVCMEPRPRPQPAERPLVLCLQTRASPFKDMILC
FSEEDWSLLDPAQTGFYGEFIIGEDCGVTVPPDDPEGQPDLSPAEDSEPRVPELPELQGR
EAPQAAYSDVPGLQPFPMEERSRWEELQVPEFQACQVPALAQSTCPVHQRIHTKEKPFEC
NECGKTFCMQSDLTIHYRTHTGEKPYECNECGKSFCQKTNPRRHQSTHTGEEPFVCTKCR
KAFHKRPLSKHARIHTALIRELTGKKPYECKECRRMFCHKSDLTVHQKTHTSERPYECGE
CEKTFSLKSALTKYHRTHI
Download sequence
Identical sequences G5C9A7
HGL_H00000355454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]