SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355459 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355459
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-19
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 2 Region: 145-220
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.93e-17
Family Nitrogenase iron protein-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355459
Sequence length 221
Comment ZNF670 (Homo_sapiens) zinc finger protein 670
Sequence
MEAVTFEDVAVTFTMEEWALLNLSQKNLYRDVMWETFINMAAVGTTWDNQEIDEAYKSCW
KNVTNEEVEKCYQYKAWSQHEEICLGTPDANGNLKQAVLKPAESFACGKSLTGDSLPNVP
ILAHTRHQICEKYRVALDLAAPCWPILTVLMRDTMKPNLTEVLKGPPVFVHTDPFPNIAH
GNFTVLADKIPLKLLGEEGFVVTAADFGADIRVAKFFNTKY
Download sequence
Identical sequences G5C7U8
HGL_H00000355459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]