SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355536 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355536
Domain Number 1 Region: 922-1259
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 4.32e-115
Family Methionine synthase SAM-binding domain 0.000000046
Further Details:      
 
Domain Number 2 Region: 9-401
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.96e-113
Family Homocysteine S-methyltransferase 0.00000994
Further Details:      
 
Domain Number 3 Region: 358-632
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 3.79e-86
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00047
Further Details:      
 
Domain Number 4 Region: 765-916
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.35e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000273
Further Details:      
 
Domain Number 5 Region: 652-741
Classification Level Classification E-value
Superfamily Methionine synthase domain 8.11e-27
Family Methionine synthase domain 0.000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355536
Sequence length 1260
Comment MTR (Homo_sapiens) 5-methyltetrahydrofolate-homocysteine methyltransferase
Sequence
MKKTLQDEIEAILQKRIMVLDGGMGTMIQRYKLSEESFQGQEFKDHARPLKGNNDILSIT
QPDIIYQIHQDYLLAGADIVETNTFSSTSIAQADYGLEHLAYRMNKCSADVARKAAEEIT
LQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLI
ETIFDTANAKAALFALKKLFEENYTPRPVFISGTIVDKSGRTLSGQTGEAFVISVSHGDP
LCIGLNCALGATEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDETPSMMAMHLKDFAM
DGLVNIVGGCCGTTPDHIREIAEAVKNCKPRVPPASVFEGHMLLSGLEPFRIGPYTNFVN
IGERCNVAGSKKFAKLIMAGNYEEALSVAKVQVEMGAQVLDVNMDDGMLDGPSAMTRFCN
LIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEEDFLEKARKIKKFGA
AVVVMAFDEEGQATETDVKISVCTRAYHLLVKKVGFNPNDIIFDPNILTIGTGMEEHNWY
AVNFIHATKVIKETLPGVRISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKFGMDMGIVN
AGNLPVYDDIQKELLKLCEDLIWNKDPEATEKLLRYAQTHGKGGKKVIQTDEWRNGPIEE
RLEYALVKGIEKYIIEDTEEARLNQEKYPRPLNIIEGPLMNGMKVVGDLFGGGKMFLPQV
IKSARVMKKAVGHLIPFMEKEREANRLITGTVEEEASAWLTFQDPYQGTIVLATVKGDVH
DIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAK
EMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEY
FEEIMEEYEDIRQDHYESLKERKYVSLSQARKNGFHIDWLSEPPPVKPTFIGTRVFEDYD
LQKLVHYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGEEARKLYDDAQNMLNILVSQKK
LQARGVVGFWPAQSVQDDIRLYAEDVVPQATEPIATFYGLRQQAEKDSASTDPYHCLSDF
IAPLHSGVRDYLGLFAVACFGVEKLSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERV
RRELWAYCDSEQLGIADLRRLRYEGIRPAPGYPSQPDHTEKLTMWRLASIEQCTGIRLTE
SLAMAPASAVSGLYFSNLNSRYFAVGKISKDQIEDYALRKNMSVAEVEKWLGPILGYDTN
Download sequence
Identical sequences G5APN0
HGL_H00000355536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]