SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355580 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355580
Domain Number 1 Region: 14-49,98-166
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-24
Family Voltage-gated potassium channels 0.0059
Further Details:      
 
Domain Number 2 Region: 162-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-22
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355580
Sequence length 336
Comment KCNK1 (Homo_sapiens) potassium channel, subfamily K, member 1
Sequence
MLQSLAGSSCVRLVERHRSAWCFGLLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK
RRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY
GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVA
IVHAVVLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK
FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIVEHDQLS
FSSITDQAAGGKEEQKQSEPFVAAQVSAYVDGSASH
Download sequence
Identical sequences G5BUP9
XP_004854693.1.39548 HGL_H00000355580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]