SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355759 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355759
Domain Number 1 Region: 915-1128
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.66e-77
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000000333
Further Details:      
 
Domain Number 2 Region: 780-916
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 3.14e-47
Family Domain of poly(ADP-ribose) polymerase 0.000000234
Further Details:      
 
Domain Number 3 Region: 638-761
Classification Level Classification E-value
Superfamily WGR domain-like 2.48e-41
Family WGR domain 0.000000256
Further Details:      
 
Domain Number 4 Region: 235-338
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-30
Family PARP-type zinc finger 0.008
Further Details:      
 
Domain Number 5 Region: 164-227
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000584
Family PARP-type zinc finger 0.036
Further Details:      
 
Domain Number 6 Region: 506-582
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000218
Family DNA ligase 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355759
Sequence length 1132
Comment PARP1 (Homo_sapiens) poly (ADP-ribose) polymerase 1
Sequence
MRIRKTAAINLMATGSPLQRWLPTKHCKRTLQLLDPSSPSQCCWRSQYCHPGGTDTLDLG
LPGLGSDLCNAKRTASSWNVFQKGPEVMNVDTLSLAACSTSAPLKTPLQEPASAALQGDV
FLKENPDPETQPQRAIQNRIGAPCGAVMKLLAGDLVFEHVTLCLSPMFDGKVPHWYHFSC
FWKMGHTIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGGKAEKTLGDFAAE
YARSNRSTCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPDCFVKNREELGFQPEY
NASQLKGFNLLSAEDKEALKKQLPGVKSEGKRKGDEVDGTDEVAKKKSKKEKDKDSKLEK
ALKAQNDLIWNIKDELKKACSTNDLKELLIFNKQQVPSGESAILDRVADGVAFGALLPCE
QCSGQLVFRSDAYYCTGDVTAWTKCMVKTQTPSRKEWVTPKEFREISYLKKLKVKKQDRI
FPPEAMAPPPTLALTPAAVNCAAPADKPLSNMKILLLGKLSRNKDEVKAAVEKLGGKLTG
SASKAGLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQHVSTSTKALQELLLAHILSPW
GAEVKAEPVEAEPPRAKSGALVPKKSKGSTKEEGIKSEKRMKLTLKGGAAVDPDSGLEHS
AHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWTFRSWGRVGTEIGSNKLE
QMPSKEDAIEHFMKLYEDKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGSK
STLPKPVQELIRMIFDVESMKKAMVEYEIDLQKMPLGKLSTRQIQAAYAILSEVQQALSQ
GSSDSQILDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLRGGS
DDSSKDPIDVNYEKLRTDIKVVDKDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIARE
GESQRYKPFKQLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVS
KSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASI
AVQGVEVPLGPGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKSSLW
Download sequence
Identical sequences G5BAN6
HGL_H00000355759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]