SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355778-9 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355778-9
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Histone-fold 1.92e-50
Family Nucleosome core histones 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355778-9
Sequence length 136
Comment H3F3A (Homo_sapiens) H3 histone, family 3A
Sequence
MARTKQTTHKSTGGKAPRKQLATKAALKSAPSTGGVKKPHRYRPGTVGLREIRRYQKSTE
LLIRKLPLQCLVREIAQDFKTDLRFQSAAIGALQEASETSLVGLFEDTNLCAIHAKRVTI
MLKDIQLARRIHGESA
Download sequence
Identical sequences G5BLX3
HGL_H00000355778-9 XP_012932411.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]