SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355827-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355827-2
Domain Number 1 Region: 873-995
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-26
Family Ankyrin repeat 0.000000267
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-22
Family Ras-binding domain, RBD 0.013
Further Details:      
 
Domain Number 3 Region: 1001-1062
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000144
Family SH3-domain 0.0000415
Further Details:      
 
Weak hits

Sequence:  HGL_H00000355827-2
Domain Number - Region: 170-210
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00523
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355827-2
Sequence length 279
Comment FBXO28 (Homo_sapiens) F-box protein 28
Sequence
VCKRMDLVCQRMLNQGFLKVERYHNLCQKQVKAQLPRRESERRNHSLARHADILAAVETR
LSLLNMTFMKYVDSNLCCFIPGKVIDEIYRVLRYVNSTRAPQRAHEVLQELRDISSMAME
YFDEKIVPILKRKLPGSDVSGRLMGSPPVPGPSAALTTMQLFSKQNPSRQEVTKLQQQVK
TNGAGVTVLRREISELRTKVQEQQKQLQDQDQKLLEQTQIIGEQNARLAELERKLREVME
SAVGSSSGAGQSEESPRKRRKATEAMDSLRKSKRLRNRK
Download sequence
Identical sequences G5C193
HGL_H00000355827-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]