SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355922 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000355922
Domain Number - Region: 1811-2062
Classification Level Classification E-value
Superfamily Tropomyosin 0.000719
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355922
Sequence length 2892
Comment CENPF (Homo_sapiens) centromere protein F, 350/400kDa (mitosin)
Sequence
MEICENLEKSKQKISHELQVKESQVNFQEGQLNSGRKQIEKLEQELKRCKSGLERSHPAA
PPADCSLCACSSLQIFAAPPTPGQPYSGSKYEDLREKYNKEVEERRRLEAEVKVLQAKRA
SQAVPPTTMNHRDIARHQASSSVFSWQQERTPNQLPSHPQKTPSRRDFSASHIFGEEEVT
PSRSVLQTGKRDTNSSCHDNSCSSPLLDQLKGQNQELRSEVNELQLRLQGQEKEMESQAH
RFQELQLQLEKTKVELIEKDKILKKNRDELARTTAQYEQAATQCTALEQKLKKLTEDLNC
QRQNAESARCALEQRVKKKEKALQEELSRQQRAFQTLDQECMQMKARLTQELQQAKNALC
GLEAELHKVTSVKQQLEKNLEELKQKFSRMEQASKDRQVEEEALRRSSQETKKENGFLRT
QSEQRAREVSHLEEELRKVQACLSQSQNFLEEMRAKNTSQETMLRDLQEKINQQENSLTL
EKLKLALADLEKQRDCSQDLLRKREHHIEQLNEKLSKIEKESKTLLSALELTKKEYEELN
EEKTQFSHWKSENEKLLYQMEAEKESLQSKINHLETCLKTQQIKSHEYNERIRTLELERD
NLSVEMRNLCSMVDSKTREAEMQKQAYEELQQKAELSDQKHKKEIENLCLQTSQLTGQVE
DLEQKLQLLSRELMDKAQLYQDLQAEYENLRDLLKSKDSSLSQGDHQRSCLAFEQQSAMS
TSFVNAMGEQGSSSSGRSQCLLDADQSPKSSAILHNRVVSLGFSLESQKQMNSNLQKQCE
ELVHIKGEIEENLIKAEQMHESFVAETSQRICKLQEDTSVHQNVVAESLVALEHKEKELQ
LWKARLESEQVEIEELKKSNQLLEDSRKELQLLSETLGSEKKEMSSVISLSKKEIEELTQ
ENGTLKEINEILNQEKMNLVQKNEKFSNCIEEQEKSISELSDQYKQEKLILLQRCEETRS
AFEDLSEKYKAAQEKNLRLECLLNECNSVCESRKNELEQLKETFAKEHQEFLTKLTFAEE
QNQKLILEFEVVQQALKSEIRDLHSSSKSEADGLRQETMTLKEEQNKMQKEVNDLLQENE
QLTKLTKTIHEGQHLKLEPLRDPVTERENEINTCNFQLQMDLGVRDIAPNNYNAQMVQLE
ALIRNTELKLQESEKDKECLQQELQTLRGELGAGNVQDCSSQEMSGLMNCEVDAEGKYSA
VLCELSPRQGDSAHSQCSLQAALSKLHELEKMCEMLQVEKLQLVSELKDSRAECITATSR
MAEEVEKLVNEMKMLNDENSLPQAEPVGEMLASEFDRQQNEQTPVSLNPLDDSNSYEQLT
LSNKEVQTHFAELQEKFSSLQSEHKILHDQRCQMSSKMSELRSYVDTLKAENSALSVNLR
NLQGDLAKGMKPEERILSLSSCVTNSPSETSFGEYSFHKDVLEQTGDTSFLSNLGESVSA
NASLEEETLTMKEAPATLERSVEELKTLCQGYLQSLKNLQEKMESQAMMKDKEIQELRQL
LSSERTELDRLRKQYLSQNEQWQQKLTSVTLEMESKLAAEKQQTEHLSLELEVARLQLQG
LELTSQSWLGADIDDAIQNHQNGSCDIKESEEYTSEITEKTPKQDSHQICEEVVQECLSV
ESEETTGSPLVPRGAREVPSETNYETAVGDQSQGCPEHTYELSTGGSCALSPVEFVENQV
SVQTLQLQVKEALNENLRLLHAIEDRDRKVENLLNEIKELDSKLDLQELQLKTKIETCLQ
LEKIVEELQKEKCNLSVKSESFSCGDQELGLRVETSLRSNLEMGTDDSSQEVLKENIAKE
DDNWKERFLDVENELNRMKAENARIEHRALTMEADLEVAQTEKLCLEKDNGNSQKVIIHL
EEELSVATSERNRLHGELDAVTKENKTLAQMSEVMKEKVQALEAEVRDRAAALQTLSLQV
SELSENKRNLQEQLRRLEGDSQTLSSAAQELESQVRRLDKEKESLARESESLQAKLSELD
QERLTVSRALEAALMERDEFAERLGSTQEEVHQLRKGMEKLRVRIEADEKKQLHVLGKLK
GSERDNDVLRDKVEGLQRELQMSEENQELVVLDAENAKAEMETLRAQLDELAESLRGSQV
DLAVLRSEKGDLTKQLQEKQGQVSELDGLLSSLKSLLEEKEQARAQMQEESKTAVEMIQA
QLRELTEEVAALCQDQEPPRAEEQNLDAPGNEVPRLRGSIGRLRARVEADREKQLHVLQQ
LKESECHADLLKGSVESLERELELSGRSQEHAVREAKDSRAEVETLKAEIQQIAQNLRDL
EVDLVNTKSEKENLTKGLQEEQARVSELEILNSSLENLLQEKEHQNVQIKEESEVAVEML
QAQLKVLDEKMITLCNDQAACKRKEQSLSSQVDSLELEKAQLLQDLEGAKNNYIILQSSV
NGLMQEVEDGKQELERKDEELSQLKGQVQDQEQLASQLSQVEGERQLWQKQKAEMGTLAV
ELEQKARELQSKNHTLQESLEGLQNSCRELESELTLTKVENMSLVEKVNTMIVKEAELQG
EMQNMVEKTTELKEEFSGEKNRLAAELNVLSEEIKSSKTDHLKYVDQLKKENERAQGKIK
LLLKSCRQLEEEKKMLQKELSDLEAAQKQKTGALVDVNVDELMAEIRELKETLEEKAKEA
DEYLDKYCSLLISYEKLEKAKEMLETQVTRLSSQHPKHGLSGSSLQSSTTPEPCPAPSVG
EGRSSSGRSKASGKRQRCSGNWESRGGLTPSTPETFPKKSRKVVKSGSIHPAEDEEEFEP
EGLSEVVKKGFADIPTGKTSPYVLRRTTVATRTSPRLAALKSALSPLSVGKENLEESSKP
TASGSRSQKVKVAQQSPVGSAEPTVTSVSVRHFSGRSPADSPGDGPRTRRSPLVPSPDAR
PQPMNSENCRVQ
Download sequence
Identical sequences G5BUR9
HGL_H00000355922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]