SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355991 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000355991
Domain Number - Region: 268-434
Classification Level Classification E-value
Superfamily Tropomyosin 0.000131
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355991
Sequence length 551
Comment TRAF3IP3 (Homo_sapiens) TRAF3 interacting protein 3
Sequence
MISPDPRRFLGLARRAESYEAKCERRQEARESRRCRPNVTMCRQAGRVLRTQQREQVRSA
RQLQFFRRRNLEAEETGQAQRLWAREQGPCRRAGRTAVFEESRSYSRRTTSPAQQVTGTS
SEAFPIQGRPPSSVHRDLADLCSSQAGALLPRDSPIKRPPKRHCGTQTKADDTQPAIKND
ASLQTNSGVAVLDKEIIQLSEYLKEALQRELVLKQKMVILQDLLSTLIQASDSSWKGQLN
EDKLKGRLRSLENQLYACTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMGAE
QQLQSTQRALGLAEQKCEEWRSQYEALKEDWRTLGAQHRELESQLHGLRSKLQGADSRDA
QMNQALRLLENEHQELQAKIECLQGDQDLYNSDSRDLQDQLKRSEEEKLALVTRVQQLQS
LLQNQSSQLHEQEKLLQKDQALPVWTPKPSPEVEPESTGKDKDWDLRDQLQKKTLQLRAK
EQECTELHSELDNLRGEYLSCLHKLQRCREELNRSLQLPPRRRCGRWLPMLMVVIAAALA
VFLANKDSLMI
Download sequence
Identical sequences G5BAM3
HGL_H00000355991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]