SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356154 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356154
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.09e-27
Family RPR domain (SMART 00582 ) 0.0071
Further Details:      
 
Domain Number 2 Region: 395-524
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-18
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356154
Sequence length 1246
Comment RBM16 (Homo_sapiens) RNA binding motif protein 16
Sequence
MTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFA
PRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAGIPPPVVTP
VLASTTTALSNTPGTPVTPVTPANVVQGLPDPWVSQITNTDTLAAVAQILQSPQGQQLQQ
LIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQLTAAAAAANTLTPLEQGVSFNKKLMD
RFDFGEDSEHTEEPKKEIPTPQLSHVSESVNNSIFHQIAEQLQQQNLEHLRQQLLEQQQP
QKATPQDSQEGTFGSEHSASPSQGSSQQHFLEPEANLDDSIDIQQQDMDIDEVQDGVQEE
VFEQEAKKVAVRSRSRTHSRSRSRSPRKRRSRSRSGSRKRKHRKRSRSRSRERKRKSSRS
YSSERRAREREKERQKKGLPPIRSKTLSVCSTTLWVGQVDKKATQQDLTNLFEEFGQIES
INMIPPRGCAYVCMVHRQDAFRALQKLSSGSYKIGSKVIKIAWALNKGVKTEYKQFWDVD
LGVTYIPWEKVKVDDLDGFAEGGMIDQETVNTEWETVKSSEPIKETVQTTQSPTLVEKEA
VVTTQAEVFPPPVAMLQIPVAPAVPTVSLVPPAFPVSMPVPPPGFSPIPPPPFLRASFNP
SQPPPGFMPPPVPPPVVPPPAIPPVVPTSLVQPPLSMTPETVKDVGFGSLVLPSGSVASG
LATATLPAGNVFNPPAKAEPEEKVPHLIEHQISSGENTRSVIANDISSNAAILGGQPPNV
TSNSGILGVQRPNVSSNSEILAVRPSNVSSSTGIIGAQPPNIINNSGILGIQPPTVSSNS
GLLGVLPPNIPNASGLVGIQPPNVTNTSGLLGTQPPAGPQNLPPLNIPSQRMPAMPMLDI
RPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDSALHPPPRGPFPPGDIFSQPERPFLAP
GRQSIDNVSNPEKRIPLGNDNIQQEGDRDYRFPLIETRDTIPRPPPVDVREVVGRPIDPR
EGPGRPPLDGRDHFGRPPVDIRENLVRPGIDHLGRRDHFGLTPEKPWGHRGDFDEREHRV
LPVYGGPKGLHEERGRFRAANYRFDPRSGPWNRGFGQEVHRDFDDRRRPWERQRDRDDRD
LDFCREMNGNRLGRDRIQNTWVPPPHARVFNYFEGATSQRKNDNVPQVNGENAERHAQPP
PLPVQNDPELYEKLTSSSEINKEKSDTVADIKSEPVVVESTETEGT
Download sequence
Identical sequences G5BQ77
HGL_H00000356154 XP_012932153.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]