SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356209 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356209
Domain Number 1 Region: 1133-1202
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000673
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number 2 Region: 1013-1090
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000271
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 
Domain Number 3 Region: 1214-1261
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000108
Family Pointed domain 0.081
Further Details:      
 
Weak hits

Sequence:  HGL_H00000356209
Domain Number - Region: 333-487
Classification Level Classification E-value
Superfamily Tropomyosin 0.000451
Family Tropomyosin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356209
Sequence length 1382
Comment PPFIA4 (Homo_sapiens) protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4
Sequence
MAHSSKAALASRASARGGASGEPGPAHRGGARVSAAKGGGASRQGAGAAEVAATSARVRL
SETCRAARVGGGSEQSCLLLDLSQLQAAANPVSPSPSPDAEKALPTPTMCEVMPTINEGD
PLGPPHGADADANFEQLMVNMLDEREKLLESLRESQETLAVTQSRLQDALHERDQLQRHL
NSALPQEFATLTRELSMCREQLLEREEEISELKAERNNTRLLLEHLECLVSRHERSLRMT
VVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVTTLEEQLAGAHQQ
VSALQQGAGVRDGAAEEEGTMELGPKRLWKEDLGRVEELQELLEKQNFELSQARERLVTL
TATVAELEEDLGTARRDLIKSEELSSKHQRDLREALAQKEDMEERITTLEKRYLAAQREA
TSIHDLNDRLENELANKESLHRQCEEKVRHLQELLEVAEQKLQQTMRKAETLPEVEAELA
QRIAALTKASGPGPGICHCPRVPSSYEAQLALVFARAEERHGNIEEHLRQLEGQLEEKNQ
ELARVRQREKMNEDHNKRLSDTVDRLLSESNERLQLHLKERMAALEEKNTLIQELESSQR
QIEEQHHHKGHLSEEIEKLRQEVDQLKGRGGPFVDGVHSRSHLGSAADMRFSLSSTAHAP
PGLHRRYSALREDSAKDWEPSPLPGMRAPKATTAFDSDPEISDVDEDEPGGLVGSVDVVS
PSGHSDAQTLAVMLQEQLDAINEEIRMIQEEKESTELRAEEIETRVTSGSMEALNLTQLR
KRGSIPTSLTALSLASASPPLSGRSTPKLASRSAAQDLDRMGVMTLPSDLRKHRRKLLSP
VSREENREDKATITCETSPPSSPRTLRLQKLGHPALSQEEGKGALEDQGSNPSSSNSSQD
SLHKGTKRKGIKSSIGRLFGKKEKGRLIQLSRDGATGHGLCPFTPEGWVWFGESEAEGYP
GPGLLCCLPRAVLLTDSELSLQEPLVPAKLGTQAEKDRRLKKKHQLLEDARRRGMPFAQW
DGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAI
QEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLATSTKTDSEEGSWAQTLAYGDMNHEWIG
NEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLN
YDRKELEKRREESQHEIKDVLVWTNDQMVHWVQSIGLRDYAGNLHESGVHGALLALDENF
DHNTLALVLQIPTQNTQARQVMEREFSNLLALGTDRKLDDGEDKVFRRAPSWRKRFRPRD
HRGGGLLSSSAETLPAAFRVPWDVAGRPATPLRSRQPCPAALPGRFAFGILLQTPGHPQP
GD
Download sequence
Identical sequences G5B371
HGL_H00000356209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]