SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356240 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356240
Domain Number 1 Region: 61-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.62e-58
Family Ankyrin repeat 0.0000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356240
Sequence length 998
Comment PPP1R12B (Homo_sapiens) protein phosphatase 1, regulatory (inhibitor) subunit 12B
Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQTQTRRGSPRVRFEDGA
VFLAACSSGDTEEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGANVGMVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDICNKLGQTPFDVADEGLVEHLEM
LQKKQNVLRNEKETRNKLIESDLNNKLQSGLFKNKEKMLYEEETLKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEPDKKPEATVNHSSSESKSRFTEQIPAPAQNTFSASSARRFS
SSLFNKPEEAKDESPSSWRLGLRKTGSHNMLSEVANSRDALRDRSSSIYRSSSSPRISAL
LDNKDKERENKSYFSSLAPRRLSSTSDIEEKENRESAVNLVRSGSYTRQLWRDETKGSET
PQTVAPSTYVSTYLKRTPYKSQGDSTAEKTADSVSASTPLSVITNRPPPGTANGVTAVTV
PSSTAADSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERT
FSCSRTERQAQEQPSEKPADIAGLEGSTKKQDPSTVLAKEAGESQQPWSKSLDEEPVYRR
LRCPTQPDKPTTPVSPSVSRPSLYTSSHLLRTSKSSVPDSEISETATNTVTAKEMDKNES
EEADLDDQSSNRLSIRERRRPRERRRGTGINFWTKDEDEAGDSEEVKETWHERLSRLESG
GSNPATSDSYSDRPSARARREAREARLASLTSRVEEDSNKDYKKLYESALTENQKLKSKL
QEAQLELADVKSKLEKMAQQKQEKTSDRSSVLETEKRERRALERKMSEMEEEMKNLHQLK
QIQTLKQMNEQLQAENRALTRVVARLSQSIESSDTQEL
Download sequence
Identical sequences G5B383
XP_004862267.1.39548 HGL_H00000356240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]