SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356436 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356436
Domain Number 1 Region: 143-721
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.25e-178
Family Lysophospholipase 8.72e-16
Further Details:      
 
Domain Number 2 Region: 16-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.36e-24
Family PLC-like (P variant) 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356436
Sequence length 749
Comment PLA2G4A (Homo_sapiens) phospholipase A2, group IVA (cytosolic, calcium-dependent)
Sequence
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNESFEFILDPNQENILEITLMDANYVMDETLGTATFPVSSMKVGEKKEV
PFIFNQVTEMILELSLEVCSCPDLRFSMALCDQEKMFRQQRKENIKENMKKLLGPKKSKG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPTEINEELMKNVSYNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDVFGMLIG
ETLIHNRMNTTLSSLKEKVNAARCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQNKGSTMEEE
LENITAKHIVSNDSSDSDDESQEPKGTENEEAEREYQNDNQASWVQRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLRDFASLDFSDDDEPDAAVADPDEFEQIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDTSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNSDVEKDCPTIIHFVLANINFRKYKAPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKDAIVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFPSKPTA
Download sequence
Identical sequences G5C6B8
XP_004862836.1.39548 HGL_H00000356436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]