SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356437 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356437
Domain Number 1 Region: 798-868
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.46e-17
Family SAM (sterile alpha motif) domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1337-1406
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000471
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 717-817
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000617
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356437
Sequence length 1414
Comment SASH1 (Homo_sapiens) SAM and SH3 domain containing 1
Sequence
MEQDAGAGGPAQDPEPDPEPDAGSSEAFSRLWADVMGILNFASSTHVLGFRHRPQTSDGR
SDLGAVLATEKGLCRVSSLAPYDPVDRDLDRKPLMGHSLQLLIHLATGRNVDHFTSICFI
SFKRLFQRDGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLDVSTMCEFGWK
KLPSEMTVTFQVQMDPSLVMEKPDASPTSLQLRSQIEESLGFSSAVSTPEVERKPPLHKS
NSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLMMM
VKEKMITIEEALARLKEYEAQHRQSAVLDPTDWPDGSYPSFDGSSTCNPEGGQGFQMYRA
ELLLAEEPAGSQLLILKSVTTFYVGILEKLDVDIDIFHRRKTEKYSSPDDLLSREQSDDE
TEESVKFKRLHKLVNSTRRVRKKLIRVEEMKKPSTEGGEEHMFENPPVLDERAALYSGVH
KKPFFIDGSAEKPPEDDTDSLTTSPSSSSLDTWGAGRKLVKTFSKGESRGLIKPPKKMGT
FFSYPEEDKAQKVSRSLTEGEMKKSLGSLSHGRTCSFGGFDLTNRSLHVGSNSSDPVGKE
GDFVYKEVIKSPTVSRISLGRKVKSVKETMRKRMSKKYNSSVSEQDSGLDGMPGSPASVQ
PGSEHMDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPY
RGPFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVD
VLNEEEEKPKRPTRRRRKGRPPQPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEE
DLDELNIRDPEHRAVLLTAVELLQEYDSNSDQSGSQEKLLVDSHGLSGCSPRDSGCYESS
ENLENGKTQKTGLLPGKSSAESSLKPFHKNQLGRYPTLPLTKSVDTRKQGEESRLGLGGS
PVVSKHCDPPCVTGLSKSRRSLPFSICRSCETLEGPQTVETWPRSHSLDDLQGQPDAGKD
VPPEVTETSPQIIPEVPQKMSAPTEKVQPPGRNSAANNASLLTQSQRCPDSQKMTPRKAE
GPPAASSCGVSPPQCLPRKFEAQPSGVRHSLTRTSLEGHKKGHDFEGTHHPPGIKEGVDT
EQRVPEPRTQPKHPSQPPPVPAKKSRERLANGLHLVSVVPGVTLPSPDAPYLPVKKASPA
DCLSAQVSRSPSGQEPDSPSCSRPPPWLSELPESATLQEHGVKLGPALSRKVSCNRGVDL
ELLTESKLHSEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPEKDVATNMDQIRVKLL
RKQHRMAIPSGGLTEICRKPLSPGCIASVSDWLISIGLPMYTSTLSDAGFSTLSQVPSLS
HTCLQEAGITEERHIRKLVSAARLFKLPPSPETM
Download sequence
Identical sequences G5BMC3
HGL_H00000356437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]