SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356595 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356595
Domain Number 1 Region: 243-515
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-84
Family Protein kinases, catalytic subunit 0.000000000266
Further Details:      
 
Domain Number 2 Region: 132-272
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-38
Family SH2 domain 0.00000263
Further Details:      
 
Domain Number 3 Region: 72-157
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356595
Sequence length 1141
Comment ABL2 (Homo_sapiens) v-abl Abelson murine leukemia viral oncogene homolog 2
Sequence
MVLGTVLLPANNYGRDQDTLLCCLCSEASGSALPNWTEALHRPYGCDVESQALNEAIRWS
SKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGW
VPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGR
VYHYRINSTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSP
IHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVM
KEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSA
MEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPES
LAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYE
LMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSIVPYLPRLPILP
SKTRTLKKAENKENIEGAQDATENPASSSAPGFIRSTQTGGSPALPRKQRDKSPSSLLED
AKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHA
DGFSFTPAQQETNLVPPKCCGGSFAQRNFCNDDSGGGGGSGTAGGGWSGITGFFTPRLIK
KTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVST
SSQPEENVDRANDMLPKKSEEGAAPTRERPKAKLLPRGATPLPLRTLSGDPAITEKDSAG
IGVAGVAAAPKGKERNGGARLGMAGVPEDGEQPGWSSPAKATAILPTTHNHKVPVLISPT
LKHTPADVQLIGTDSQGNKFKLLSEHQGTSSGDKDRPRRVKPKCAPPPPPVMRLLQHSSV
CPDPGEEPPAGQPMSEIQEGGKKASPGAVPVGGKAGRPVMPPPQVPLPTPSISPAKMANG
TAGTKVALRKTKQAAEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCS
GYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGGNPVLNNLLSCVQEISDVVQ
R
Download sequence
Identical sequences G5C7J7
HGL_H00000356595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]