SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356685 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356685
Domain Number 1 Region: 41-174
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-22
Family Ankyrin repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 169-243
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000000031
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356685
Sequence length 245
Comment ANKRD45 (Homo_sapiens) ankyrin repeat domain 45
Sequence
VFVELMEPEAQLESESSEKSLFFSQEEEESQEPEETGIKNPLTKPALTGDVEGLQKIFED
PENPHHKDAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTARGYTLLHCA
AAWGRLETLKALVELDVDIEALNFREEKARDVAARYSQTECVEFLDWADARLALKKYIAK
VSLTITDSEKGPGKLLKEDKNTILNACRVKNEWLETHPEASINELFEQRKHLEDIVTPIF
TKMAT
Download sequence
Identical sequences HGL_H00000356685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]