SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356850 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356850
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-17
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 2 Region: 255-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000017
Family Centromere-binding 0.01
Further Details:      
 
Weak hits

Sequence:  HGL_H00000356850
Domain Number - Region: 196-238
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0143
Family Cgl2762-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356850
Sequence length 612
Comment POGK (Homo_sapiens) pogo transposable element with KRAB domain
Sequence
MEPTAYPLNVTLKEEQEEEEIRSRELEDGPTDMQKVRICSEGGWVPALFDEVAIYFSDEE
WEVLTEQQKALYREVMRMNYETVLSLEFPFPKPDMISRLEREEESHNSDEWQLQKGTFAE
NEDSDLKPPDWASPMHTASQFPPPQHLDRFSLRLPRCITELPEWSEGYPFYMAMGFPGYD
FSADDIAGKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQ
LQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPE
KGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLITYQRSVLALRRAHDYEVAQM
GNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAAGTVPKQRGMLILNGFRGHA
TDSVKSSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTG
NAKKPPLGLFLEWVMVAWNSISSESIVEGFKKCHISSNLEEEDDMLWEIESELPGGAEPA
KECDTESMTEGH
Download sequence
Identical sequences G5AQ39
XP_004865248.1.39548 XP_004865249.1.39548 HGL_H00000356850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]