SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356992 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356992
Domain Number 1 Region: 16-215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.44e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000743
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356992
Sequence length 1103
Comment ARHGAP30 (Homo_sapiens) Rho GTPase activating protein 30
Sequence
MKSRQKGKKKGNSKERVFGCDLQEHLQQSGQEVPQVLRSCAEFVEEYGVVDGIYRLSGVS
SNIQKLRQEFETERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVAV
QLEPERLVKILEVLRELPAPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRS
KDIEASGFNGTAAFMEVRVQSIVVEFILTHVDQLFGGAALLSGGEMESGWRSTPGARALG
NPDDLMPRSLPCHVPSVLQAGDGPPQIRPYHTIIEIAEHKRKGSLKVRKWRSIFNLGRSG
HETKRKLPRGAEDREDKPNKGTLRPAKSMDSLSAAVGASDEPEGLAGPSSLGPGPLLSES
LENNSMETVEGEQEPEAEAPGGTNSEPGTPRAGRSAIRVGGSSRAERCAGVHISDPYNVN
LPLHITSILSVPPNIISNVSLARLTRGLECPALQPRPSPASGPGPGPGLGPGPPDEKSEA
RPAPGPVADSGPVDMIPALEDCLSQEVQDSFSFLEDSSSSEPEWVGVEDGEVAKAGATGT
AFSPGEDDPGMGYLEELLGVGPQVEEFSVEPPLDDLSLDEAQYVLAPSCCSLDSAGPKPE
VEEENGEEVFLSAYDDLSPLLGPQSLTWESVGSMEEEAVGFERQAPRRAEEEQECWGVGE
DKEPEPGKTLNIREEAKGGSEMEVVDGKGGEEGEGAEGSQEGIISLEEANGEEKEAKGEK
SQGQEAVEDIEEAKNVQEPRGEQDKDREKEKQIKREEAQQGGEEAPLEVGRDPEHGTQEH
PVAKEKWDVHKQEAEGGRQREVKEQKGDEDHKAREDQGHGEDGRSPEAAAESGVVIKEPE
CGAEQAERDQRAGDGHLEEGTLFEGPGVEFLEVDSTNEGNIQFSEMEQATPQPPQAEETE
TEGRLSSVGCDLCPCPFGSAGSVGMRLTSSLVHVQQVRSVPVVPPKPQFAKVPSTMCSKI
HVAPANPCPRPGRLDGIPGERAWVSRASRASWRNGGSLSFDAAVALARDRQRTEAQGVRR
TQTCTGGGDYSLIHRTSPCHTIPAYSPRPLSCLELPPEGTEDSGPRSRLSLPSREPQPPV
PLLSPQRRSYAFETQVSPGKGGL
Download sequence
Identical sequences G5BWJ0
HGL_H00000356992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]