SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357067 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357067
Domain Number 1 Region: 146-341
Classification Level Classification E-value
Superfamily E set domains 1.45e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 38-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.46e-23
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357067
Sequence length 393
Comment KCNJ9 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 9
Sequence
MAQENAAFSPGPEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGGPGDDKEQNGCLPPPEDESKV
Download sequence
Identical sequences G5BWL1
XP_012932934.1.39548 HGL_H00000357067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]